Brand: ProteoGenix

Anti-Human IL12A/IL-12 p35/NKSF1 Antibody (SAA0380)

ARO-A15571-50
Quality Chart

Original price was: €289.00.Current price is: €239.00.

50ug 17% OFF + 239 loyalty points

Size Size

50ug Original price was: €289.00.Current price is: €239.00.
100ug Original price was: €431.00.Current price is: €342.00.
1MG Original price was: €1,309.00.Current price is: €992.00.

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Free shipping in EU on orders > €500
Wide range of unique reagents
Fast worldwide delivery

SDS-PAGE for Anti-Human IL12A/IL-12 p35/NKSF1 Antibody (SAA0380)

Datasheet

Anti-Human IL12A/IL-12 p35/NKSF1 Antibody (SAA0380)

Product name	ARO-A15571-100
Uniprot ID	P29459
Raw Antigen Sequence	MCPARSLLLVATLVLLDHLSLARNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS
Form	0.01M PBS, pH 7.4, 0.09% Sodium azide.
Delivery condition	Blue ice (+4°C)
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Reactivity	Human
Reference	ARO-A15571
Isotype	IgG2a, kappa
Clonality	Monoclonal Antibody
Purification	Protein A or G purified.
Immunogen	IL12A/IL-12 p35/NKSF1
Clone Name	SAA0380
Protein Name	IL12A/IL-12 p35/NKSF1
Target species	Anti-Human Monoclonal Antibody

Product name	ARO-A15571-1MG
Uniprot ID	P29459
Raw Antigen Sequence	MCPARSLLLVATLVLLDHLSLARNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS
Form	0.01M PBS, pH 7.4, 0.09% Sodium azide.
Delivery condition	Blue ice (+4°C)
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Reactivity	Human
Reference	ARO-A15571
Isotype	IgG2a, kappa
Clonality	Monoclonal Antibody
Purification	Protein A or G purified.
Immunogen	IL12A/IL-12 p35/NKSF1
Clone Name	SAA0380
Protein Name	IL12A/IL-12 p35/NKSF1
Target species	Anti-Human Monoclonal Antibody

Product name	ARO-A15571-50
Uniprot ID	P29459
Raw Antigen Sequence	MCPARSLLLVATLVLLDHLSLARNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS
Form	0.01M PBS, pH 7.4, 0.09% Sodium azide.
Delivery condition	Blue ice (+4°C)
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Reactivity	Human
Reference	ARO-A15571
Isotype	IgG2a, kappa
Clonality	Monoclonal Antibody
Purification	Protein A or G purified.
Immunogen	IL12A/IL-12 p35/NKSF1
Clone Name	SAA0380
Protein Name	IL12A/IL-12 p35/NKSF1
Target species	Anti-Human Monoclonal Antibody

Datasheet

SDS-PAGE for Anti-Human IL12A/IL-12 p35/NKSF1 Antibody (SAA0380)

Anti-Human IL12A/IL-12 p35/NKSF1 Antibody (SAA0380), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.