Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-Human CXCL12/SDF-1 Antibody (SAA0467)

  • ARO-A15487-50
  • Validated ELISA FC

Original price was: €294.00.Current price is: €239.00.

50ug 19% OFF + 239 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-Human CXCL12/SDF-1 Antibody (SAA0467)

Product name ARO-A15487-100
Uniprot ID P48061
Raw Antigen Sequence MNAKVVVVLVLVLTALCLSDGKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKM
Form 0.01M PBS, pH 7.4, 0.09% Sodium azide.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Reactivity Human
Reference ARO-A15487
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CXCL12/SDF-1
Clone Name SAA0467
Protein Name CXCL12/SDF-1
Target species Anti-Human Monoclonal Antibody
Product name ARO-A15487-1MG
Uniprot ID P48061
Raw Antigen Sequence MNAKVVVVLVLVLTALCLSDGKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKM
Form 0.01M PBS, pH 7.4, 0.09% Sodium azide.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Reactivity Human
Reference ARO-A15487
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CXCL12/SDF-1
Clone Name SAA0467
Protein Name CXCL12/SDF-1
Target species Anti-Human Monoclonal Antibody
Product name ARO-A15487-50
Uniprot ID P48061
Raw Antigen Sequence MNAKVVVVLVLVLTALCLSDGKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKM
Form 0.01M PBS, pH 7.4, 0.09% Sodium azide.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Reactivity Human
Reference ARO-A15487
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CXCL12/SDF-1
Clone Name SAA0467
Protein Name CXCL12/SDF-1
Target species Anti-Human Monoclonal Antibody

Anti-Human CXCL12/SDF-1 Antibody (SAA0467) binds to Stromal cell-derived factor 1(CXCL12) in ELISA Assay

Anti-Human CXCL12/SDF-1 Antibody (SAA0467) binds to Stromal cell-derived factor 1(CXCL12) in ELISA Assay

Stromal cell-derived factor 1(CXCL12)(cat. No.PX-P4857) at 0.5µg/mL (100µL/well) can bind Anti-Human CXCL12/SDF-1 Antibody (SAA0467) in indirect ELISA with Goat secondary antibody measured by OD450.

Flow Cytometry results for Anti-Human CXCL12/SDF-1 Antibody (SAA0467)

Flow Cytometry results for Anti-Human CXCL12/SDF-1 Antibody (SAA0467)

Flow-cytometry using anti-human CXCL12 antibody.MDA-MB-453 cells were stained with an irrelevant antibody (Blue Histogram) or an anti-human CXCL12 antibody monoclonal antibody (Catalog # ARO-A15487 ,Green Histogram) at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using a FITC conjugated goat anti-mouse antibody (Catalog # PTX17818) and cells analysed on a NovoCyte Flow Cytometer.

Anti-Human CXCL12/SDF-1 Antibody (SAA0467)

There are no reviews yet.

Be the first to review “Anti-Human CXCL12/SDF-1 Antibody (SAA0467)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products