Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-Human IL11 Monoclonal Antibody (X203)

  • PTX25416-50
  • Validated ELISA WB
Clonality:
Monoclonal Antibody
Host species:
Human
Isotype:
IgG1, kappa

Original price was: €339.00.Current price is: €265.00.

50ug 22% OFF + 265 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-Human IL11 Monoclonal Antibody (X203)

Product name PTX25416-100
Uniprot ID P20809
Raw Antigen Sequence MNCVCRLVLVVLSLWPDTAVAPGPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Aliases /Synonyms Anti-IL11, Anti-IL-11, Anti-AGIF, EnX203, EnX 203, EnX-203, X203
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Protein Name IL11
Product name PTX25416-1MG
Uniprot ID P20809
Raw Antigen Sequence MNCVCRLVLVVLSLWPDTAVAPGPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Aliases /Synonyms Anti-IL11, Anti-IL-11, Anti-AGIF, EnX203, EnX 203, EnX-203, X203
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Protein Name IL11
Product name PTX25416-50
Uniprot ID P20809
Raw Antigen Sequence MNCVCRLVLVVLSLWPDTAVAPGPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Aliases /Synonyms Anti-IL11, Anti-IL-11, Anti-AGIF, EnX203, EnX 203, EnX-203, X203
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Protein Name IL11

Anti-Human IL11 Monoclonal Antibody (X203) binds to Human IL11 Recombinant Protein, N-GST & C-His in WB Assay

Anti-Human IL11 Monoclonal Antibody (X203) binds to Human IL11 Recombinant Protein, N-GST & C-His in WB Assay

Human IL11 Recombinant Protein, N-GST & C-His(cat. No.ARO-P18107) can bind Anti-Human IL11 Monoclonal Antibody (X203) in Western Blot Assay as detected on gel analysis.

Anti-Human IL11 Monoclonal Antibody (X203) binds to Human IL11 Recombinant Protein, N-GST & C-His in ELISA Assay

Anti-Human IL11 Monoclonal Antibody (X203) binds to Human IL11 Recombinant Protein, N-GST & C-His in ELISA Assay

Human IL11 Recombinant Protein, N-GST & C-His(cat. No.ARO-P18107) at 0.5µg/mL (100µL/well) can bind Anti-Human IL11 Monoclonal Antibody (X203) in indirect ELISA with Goat secondary antibody measured by OD450.

There are no reviews yet.

Be the first to review “Anti-Human IL11 Monoclonal Antibody (X203)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products