Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-Dog IL31 Monoclonal Antibody (ABS0678)

  • PTX25858-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG2, Kappa

Original price was: €347.00.Current price is: €265.00.

50ug 24% OFF + 265 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-Dog IL31 Monoclonal Antibody (ABS0678)

Product name PTX25858-100
Uniprot ID C7G0W1
Raw Antigen Sequence MLSHTGPSRFALFLLCSMETLLSSHMAPTHQLPPSDVRKIILELQPLSRGLLEDYQKKETGVPESNRTLLLCLTSDSQPPRLNSSAILPYFRAIRPLSDKNIIDKIIEQLDKLKFQHEPETEISVPADTFECKSFILTILQQFSACLESVFKSLNSGPQ
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Aliases /Synonyms Anti-Lokivetmab, Anti-IL31, Anti-Interleukin-31, CAN34D3-65, PF-06443537, CAS: 1533403-95-0
Isotype IgG2, Kappa
Clonality Monoclonal Antibody
Protein Name Lokivetmab
Product name PTX25858-1MG
Uniprot ID C7G0W1
Raw Antigen Sequence MLSHTGPSRFALFLLCSMETLLSSHMAPTHQLPPSDVRKIILELQPLSRGLLEDYQKKETGVPESNRTLLLCLTSDSQPPRLNSSAILPYFRAIRPLSDKNIIDKIIEQLDKLKFQHEPETEISVPADTFECKSFILTILQQFSACLESVFKSLNSGPQ
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Aliases /Synonyms Anti-Lokivetmab, Anti-IL31, Anti-Interleukin-31, CAN34D3-65, PF-06443537, CAS: 1533403-95-0
Isotype IgG2, Kappa
Clonality Monoclonal Antibody
Protein Name Lokivetmab
Product name PTX25858-50
Uniprot ID C7G0W1
Raw Antigen Sequence MLSHTGPSRFALFLLCSMETLLSSHMAPTHQLPPSDVRKIILELQPLSRGLLEDYQKKETGVPESNRTLLLCLTSDSQPPRLNSSAILPYFRAIRPLSDKNIIDKIIEQLDKLKFQHEPETEISVPADTFECKSFILTILQQFSACLESVFKSLNSGPQ
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Aliases /Synonyms Anti-Lokivetmab, Anti-IL31, Anti-Interleukin-31, CAN34D3-65, PF-06443537, CAS: 1533403-95-0
Isotype IgG2, Kappa
Clonality Monoclonal Antibody
Protein Name Lokivetmab

SDS-PAGE for Anti-Dog IL31 Monoclonal Antibody (ABS0678)

SDS-PAGE for Anti-Dog IL31 Monoclonal Antibody (ABS0678)

Anti-Dog IL31 Monoclonal Antibody (ABS0678), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

SEC-HPLC of Anti-Dog IL31 Monoclonal Antibody (ABS0678)

SEC-HPLC of Anti-Dog IL31 Monoclonal Antibody (ABS0678)

Anti-Dog IL31 Monoclonal Antibody (ABS0678) was analyzed by size exclusion chromatography with UV detection.

There are no reviews yet.

Be the first to review “Anti-Dog IL31 Monoclonal Antibody (ABS0678)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products