Brand: ProteoGenix

Anti-Human HBEGF VHH (SAA1356)

ARO-A16361
Quality Chart

Note:: For research use only. Not suitable for human use.

€380.00

100ug + 380 loyalty points

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Free shipping in EU on orders > €500
Wide range of unique reagents
Fast worldwide delivery

Datasheet

Anti-Human HBEGF VHH (SAA1356)

Product name	Anti-Human HBEGF VHH (SAA1356)
Uniprot ID	Q99075
Raw Antigen Sequence	MKLLPSVVLKLFLAAVLSALVTGESLERLRRGLAAGTSNPDPPTVSTDQLLPLGGGRDRKVRDLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHGERCHGLSLPVENRLYTYDHTTILAVVAVVLSSVCLLVIVGLLMFRYHRRGGYDVENEEKVKLGMTNSH
Form	0.01M PBS, pH 7.4.
Delivery condition	Blue ice (+4°C)
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Host species	XtenCHO
Reactivity	Human
Aliases /Synonyms	anti-DTR, anti-DT-R, anti-DTS, anti-HEGFL, anti-HB-EGF, anti-HBEGF, anti-Proheparin-binding EGF-like growth factor, anti-Diphtheria toxin receptor
Reference	ARO-A16361
Note	For research use only. Not suitable for human use.
Isotype	VHH-8His-Cys-tag
Clonality	Monoclonal Antibody
Immunogen	HBEGF
Clone Name	SAA1356
Target species	Anti-Human Monoclonal Antibody