Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Anti-Human GZMB Antibody (SAA0515)

  • ARO-A15301-50
  • Validated ELISA WB

Original price was: €375.00.Current price is: €272.00.

50ug 27% OFF + 272 loyalty points
Size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
SEC-HPLC of Anti-Human GZMB Antibody (SAA0515)
SDS-PAGE for Anti-Human GZMB Antibody (SAA0515)
Anti-Human GZMB Antibody (SAA0515)

Anti-Human GZMB Antibody (SAA0515)

Product name ARO-A15301-100
Uniprot ID P10144
Raw Antigen Sequence MQPILLLLAFLLLPRADAGEIIGGHEAKPHSRPYMAYLMIWDQKSLKRCGGFLIRDDFVLTAAHCWGSSINVTLGAHNIKEQEPTQQFIPVKRPIPHPAYNPKNFSNDIMLLQLERKAKRTRAVQPLRLPSNKAQVKPGQTCSVAGWGQTAPLGKHSHTLQEVKMTVQEDRKCESDLRHYYDSTIELCVGDPEIKKTSFKGDSGGPLVCNKVAQGIVSYGRNNGMPPRACTKVSSFVHWIKKTMKRY
Form 0.01M PBS, pH 7.4.
Delivery condition Dry ice
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Reference ARO-A15301
Isotype IgG1
Clonality Monoclonal Antibody
Purification Protein A or G purified from cell culture supernatant.
Immunogen Granzyme-B,Cathepsin G-like 1, Granzyme-2, GZMB, Fragmentin-2, Human lymphocyte protein, HLP, CTLA-1, CGL1, CTSGL1, CSPB, Lymphocyte protease, T-cell serine protease 1-3E, Granzyme B, CTLA1, GRB, C11, Cytotoxic T-lymphocyte proteinase 2, SECT
Target species Anti-Human Monoclonal Antibody
Product name ARO-A15301-1MG
Uniprot ID P10144
Raw Antigen Sequence MQPILLLLAFLLLPRADAGEIIGGHEAKPHSRPYMAYLMIWDQKSLKRCGGFLIRDDFVLTAAHCWGSSINVTLGAHNIKEQEPTQQFIPVKRPIPHPAYNPKNFSNDIMLLQLERKAKRTRAVQPLRLPSNKAQVKPGQTCSVAGWGQTAPLGKHSHTLQEVKMTVQEDRKCESDLRHYYDSTIELCVGDPEIKKTSFKGDSGGPLVCNKVAQGIVSYGRNNGMPPRACTKVSSFVHWIKKTMKRY
Form 0.01M PBS, pH 7.4.
Delivery condition Dry ice
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Reference ARO-A15301
Isotype IgG1
Clonality Monoclonal Antibody
Purification Protein A or G purified from cell culture supernatant.
Immunogen Granzyme-B,Cathepsin G-like 1, Granzyme-2, GZMB, Fragmentin-2, Human lymphocyte protein, HLP, CTLA-1, CGL1, CTSGL1, CSPB, Lymphocyte protease, T-cell serine protease 1-3E, Granzyme B, CTLA1, GRB, C11, Cytotoxic T-lymphocyte proteinase 2, SECT
Target species Anti-Human Monoclonal Antibody
Product name ARO-A15301-50
Uniprot ID P10144
Raw Antigen Sequence MQPILLLLAFLLLPRADAGEIIGGHEAKPHSRPYMAYLMIWDQKSLKRCGGFLIRDDFVLTAAHCWGSSINVTLGAHNIKEQEPTQQFIPVKRPIPHPAYNPKNFSNDIMLLQLERKAKRTRAVQPLRLPSNKAQVKPGQTCSVAGWGQTAPLGKHSHTLQEVKMTVQEDRKCESDLRHYYDSTIELCVGDPEIKKTSFKGDSGGPLVCNKVAQGIVSYGRNNGMPPRACTKVSSFVHWIKKTMKRY
Form 0.01M PBS, pH 7.4.
Delivery condition Dry ice
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Reference ARO-A15301
Isotype IgG1
Clonality Monoclonal Antibody
Purification Protein A or G purified from cell culture supernatant.
Immunogen Granzyme-B,Cathepsin G-like 1, Granzyme-2, GZMB, Fragmentin-2, Human lymphocyte protein, HLP, CTLA-1, CGL1, CTSGL1, CSPB, Lymphocyte protease, T-cell serine protease 1-3E, Granzyme B, CTLA1, GRB, C11, Cytotoxic T-lymphocyte proteinase 2, SECT
Target species Anti-Human Monoclonal Antibody

SEC-HPLC of Anti-Human GZMB Antibody (SAA0515)

SEC-HPLC of Anti-Human GZMB Antibody (SAA0515)

Anti-Human GZMB Antibody (SAA0515)was analyzed by size exclusion chromatography with UV detection.

SDS-PAGE for Anti-Human GZMB Antibody (SAA0515)

SDS-PAGE for Anti-Human GZMB Antibody (SAA0515)

Anti-Human GZMB Antibody (SAA0515), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Anti-Human GZMB Antibody (SAA0515)

There are no reviews yet.

Be the first to review “Anti-Human GZMB Antibody (SAA0515)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products