Brand: ProteoGenix

Anti-Human DRD2 VHH (SAA1361)

ARO-A16436
Quality Chart

Note:: For research use only. Not suitable for human use.

€380.00

100ug + 380 loyalty points

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Free shipping in EU on orders > €500
Wide range of unique reagents
Fast worldwide delivery

Datasheet

Anti-Human DRD2 VHH (SAA1361)

Product name	Anti-Human DRD2 VHH (SAA1361)
Uniprot ID	P14416
Raw Antigen Sequence	MDPLNLSWYDDDLERQNWSRPFNGSDGKADRPHYNYYATLLTLLIAVIVFGNVLVCMAVSREKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMISIVWVLSFTISCPLLFGLNNADQNECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRRRRKRVNTKRSSRAFRAHLRAPLKGNCTHPEDMKLCTVIMKSNGSFPVNRRRVEAARRAQELEMEMLSSTSPPERTRYSPIPPSHHQLTLPDPSHHGLHSTPDSPAKPEKNGHAKDHPKIAKIFEIQTMPNGKTRTSLKTMSRRKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNSAVNPIIYTTFNIEFRKAFLKILHC
Form	0.01M PBS, pH 7.4.
Delivery condition	Blue ice (+4°C)
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Host species	XtenCHO
Reactivity	Human
Aliases /Synonyms	anti-D(2) dopamine receptor, anti-Dopamine D2 receptor, anti-DRD2
Reference	ARO-A16436
Note	For research use only. Not suitable for human use.
Isotype	VHH-8His-Cys-tag
Clonality	Monoclonal Antibody
Immunogen	DRD2
Clone Name	SAA1361
Target species	Anti-Human Monoclonal Antibody

Datasheet

There are no reviews yet.

Be the first to review “Anti-Human DRD2 VHH (SAA1361)”

Your email address will not be published. Required fields are marked *

Your rating *

In which application did you use the antibody? *

Did it work in your application? * Yes No

Your review *

Name *

Email *

Anti-Human DRD2 VHH (SAA1361)

Anti-Human DRD2 VHH (SAA1361)

Recently viewed products

Can’t find what you need?

Cart (0 Items)

Anti-Human DRD2 VHH (SAA1361)

Specifications Anti-Human DRD2 VHH (SAA1361)

Documents

3D Representation

Reviews

Recently viewed products

Can’t find what you need?

Cart (0 Items)

Anti-Human DRD2 VHH (SAA1361)