Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-Human CD275/ICOSLG Antibody (SAA0089), FITC

  • ARO-A10963-50
  • Validated FC
Clonality:
Monoclonal Antibody
Host species:
Human
Isotype:
IgG2, kappa
Target species:
Human
Clone Name:
SAA0089

Original price was: €335.00.Current price is: €272.00.

50ug 19% OFF + 272 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-Human CD275/ICOSLG Antibody (SAA0089), FITC

Product name ARO-A10963-100
Uniprot ID O75144
Raw Antigen Sequence MRLGSPGLLFLLFSSLRADTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWSILAVLCLLVVVAVAIGWVCRDRCLQHSYAGAWAVSPETELTGHV
Buffer 0.01M PBS, pH 7.4, 0.2% BSA, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Human
Aliases /Synonyms Anti-B7RP1, B7-related protein 1, CD275, ICOSL, ICOSLG, KIAA0653, B7 homolog 2, ICOS ligand, B7RP-1, B7H2, B7-H2, B7-like protein Gl50
Reference ARO-A10963
Note For research use only.
Isotype IgG2, kappa
Clonality Monoclonal Antibody
Target B7RP1, B7-related protein 1, CD275, ICOSL, ICOSLG, KIAA0653, B7 homolog 2, ICOS ligand, B7RP-1, B7H2, B7-H2, B7-like protein Gl50
Clone Name SAA0089
Target species Human
Product name ARO-A10963-1MG
Uniprot ID O75144
Raw Antigen Sequence MRLGSPGLLFLLFSSLRADTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWSILAVLCLLVVVAVAIGWVCRDRCLQHSYAGAWAVSPETELTGHV
Buffer 0.01M PBS, pH 7.4, 0.2% BSA, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Human
Aliases /Synonyms Anti-B7RP1, B7-related protein 1, CD275, ICOSL, ICOSLG, KIAA0653, B7 homolog 2, ICOS ligand, B7RP-1, B7H2, B7-H2, B7-like protein Gl50
Reference ARO-A10963
Note For research use only.
Isotype IgG2, kappa
Clonality Monoclonal Antibody
Target B7RP1, B7-related protein 1, CD275, ICOSL, ICOSLG, KIAA0653, B7 homolog 2, ICOS ligand, B7RP-1, B7H2, B7-H2, B7-like protein Gl50
Clone Name SAA0089
Target species Human
Product name ARO-A10963-50
Uniprot ID O75144
Raw Antigen Sequence MRLGSPGLLFLLFSSLRADTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWSILAVLCLLVVVAVAIGWVCRDRCLQHSYAGAWAVSPETELTGHV
Buffer 0.01M PBS, pH 7.4, 0.2% BSA, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Human
Aliases /Synonyms Anti-B7RP1, B7-related protein 1, CD275, ICOSL, ICOSLG, KIAA0653, B7 homolog 2, ICOS ligand, B7RP-1, B7H2, B7-H2, B7-like protein Gl50
Reference ARO-A10963
Note For research use only.
Isotype IgG2, kappa
Clonality Monoclonal Antibody
Target B7RP1, B7-related protein 1, CD275, ICOSL, ICOSLG, KIAA0653, B7 homolog 2, ICOS ligand, B7RP-1, B7H2, B7-H2, B7-like protein Gl50
Clone Name SAA0089
Target species Human

Flow Cytometry results for Anti-Human CD275/ICOSLG Antibody (SAA0089), FITC

Flow Cytometry results for Anti-Human CD275/ICOSLG Antibody (SAA0089), FITC

Target Cells were stained with an irrelevant antibody or Anti-Human CD275/ICOSLG Antibody (SAA0089), FITC at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using Goat Anti-Human IgG Polyclonal Antibody, FITC (PTX18862) and cells analysed on a NovoCyte Flow Cytometer.

There are no reviews yet.

Be the first to review “Anti-Human CD275/ICOSLG Antibody (SAA0089), FITC”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products