Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-Human CD252/TNFSF4/OX40L VHH (SAA1277)

  • ARO-A16428-50
  • Validated ELISA
Note:
For research use only. Not suitable for human use.

Original price was: €362.00.Current price is: €266.00.

50ug 27% OFF + 266 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-Human CD252/TNFSF4/OX40L VHH (SAA1277)

Product name ARO-A16428-100
Uniprot ID P23510
Raw Antigen Sequence MERVQPLEENVGNAARPRFERNKLLLVASVIQGLGLLLCFTYICLHFSALQVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species XtenCHO
Reactivity Human
Aliases /Synonyms anti-CD252, anti-OX40L, anti-TXGP1, anti-OX40 ligand, anti-Glycoprotein Gp34, anti-TAX transcriptionally-activated glycoprotein 1, anti-TNFSF4, anti-Tumor necrosis factor ligand superfamily member 4
Reference ARO-A16428
Note For research use only. Not suitable for human use.
Isotype VHH-8His-Cys-tag
Clonality Monoclonal Antibody
Immunogen CD252/TNFSF4/OX40L
Clone Name SAA1277
Target species Anti-Human Monoclonal Antibody
Product name ARO-A16428-1MG
Uniprot ID P23510
Raw Antigen Sequence MERVQPLEENVGNAARPRFERNKLLLVASVIQGLGLLLCFTYICLHFSALQVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species XtenCHO
Reactivity Human
Aliases /Synonyms anti-CD252, anti-OX40L, anti-TXGP1, anti-OX40 ligand, anti-Glycoprotein Gp34, anti-TAX transcriptionally-activated glycoprotein 1, anti-TNFSF4, anti-Tumor necrosis factor ligand superfamily member 4
Reference ARO-A16428
Note For research use only. Not suitable for human use.
Isotype VHH-8His-Cys-tag
Clonality Monoclonal Antibody
Immunogen CD252/TNFSF4/OX40L
Clone Name SAA1277
Target species Anti-Human Monoclonal Antibody
Product name ARO-A16428-50
Uniprot ID P23510
Raw Antigen Sequence MERVQPLEENVGNAARPRFERNKLLLVASVIQGLGLLLCFTYICLHFSALQVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species XtenCHO
Reactivity Human
Aliases /Synonyms anti-CD252, anti-OX40L, anti-TXGP1, anti-OX40 ligand, anti-Glycoprotein Gp34, anti-TAX transcriptionally-activated glycoprotein 1, anti-TNFSF4, anti-Tumor necrosis factor ligand superfamily member 4
Reference ARO-A16428
Note For research use only. Not suitable for human use.
Isotype VHH-8His-Cys-tag
Clonality Monoclonal Antibody
Immunogen CD252/TNFSF4/OX40L
Clone Name SAA1277
Target species Anti-Human Monoclonal Antibody

Anti-Human CD252/TNFSF4/OX40L VHH (SAA1277) in ELISA Assay

Anti-Human CD252/TNFSF4/OX40L VHH (SAA1277) in ELISA Assay

Anti-Human CD252/TNFSF4/OX40L VHH (SAA1277) can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

SDS-PAGE for Anti-Human CD252/TNFSF4/OX40L VHH (SAA1277)

SDS-PAGE for Anti-Human CD252/TNFSF4/OX40L VHH (SAA1277)

Anti-Human CD252/TNFSF4/OX40L VHH (SAA1277), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Anti-Human CD252/TNFSF4/OX40L VHH (SAA1277)

There are no reviews yet.

Be the first to review “Anti-Human CD252/TNFSF4/OX40L VHH (SAA1277)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products