Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Anti-Human BAX Antibody Antibody (6A7)

  • ARO-A14609-50
  • Validated ELISA FC

Original price was: €306.00.Current price is: €239.00.

50ug 22% OFF + 239 loyalty points
Size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Flow Cytometry results for Anti-Human BAX Antibody Antibody (6A7)
SEC-HPLC of Anti-Human BAX Antibody Antibody (6A7)
Anti-Human BAX Antibody Antibody (6A7)

Anti-Human BAX Antibody Antibody (6A7)

Product name ARO-A14609-100
Uniprot ID Q07812
Raw Antigen Sequence MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Reference ARO-A14609
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified from cell culture supernatant.
Immunogen BAX, Bcl2-L-4, BCL2L4, Bcl-2-like protein 4, Apoptosis regulator BAX
Target species Anti-Human Monoclonal Antibody
Product name ARO-A14609-1MG
Uniprot ID Q07812
Raw Antigen Sequence MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Reference ARO-A14609
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified from cell culture supernatant.
Immunogen BAX, Bcl2-L-4, BCL2L4, Bcl-2-like protein 4, Apoptosis regulator BAX
Target species Anti-Human Monoclonal Antibody
Product name ARO-A14609-50
Uniprot ID Q07812
Raw Antigen Sequence MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Reference ARO-A14609
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified from cell culture supernatant.
Immunogen BAX, Bcl2-L-4, BCL2L4, Bcl-2-like protein 4, Apoptosis regulator BAX
Target species Anti-Human Monoclonal Antibody

Flow Cytometry results for Anti-Human BAX Antibody Antibody (6A7)

Flow Cytometry results for Anti-Human BAX Antibody Antibody (6A7)

Target Cells were stained with an irrelevant antibody or Anti-Human BAX Antibody Antibody (6A7) at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using Goat Anti-Human IgG Polyclonal Antibody, FITC (PTX18862) and cells analysed on a NovoCyte Flow Cytometer.

SEC-HPLC of Anti-Human BAX Antibody Antibody (6A7)

SEC-HPLC of Anti-Human BAX Antibody Antibody (6A7)

Anti-Human BAX Antibody Antibody (6A7)was analyzed by size exclusion chromatography with UV detection.

Anti-Human BAX Antibody Antibody (6A7)

There are no reviews yet.

Be the first to review “Anti-Human BAX Antibody Antibody (6A7)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products