Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Anti-Human ATF4/CREB2 Antibody (SAA0818)

  • ARO-A14680-50
  • Validated WB

Original price was: €364.00.Current price is: €272.00.

50ug 25% OFF + 272 loyalty points
Size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
SDS-PAGE for Anti-Human ATF4/CREB2 Antibody (SAA0818)
Anti-Human ATF4/CREB2 Antibody (SAA0818) binds to Recombinant Human ATF4 Protein, N-His in WB Assay
Anti-Human ATF4/CREB2 Antibody (SAA0818)

Anti-Human ATF4/CREB2 Antibody (SAA0818)

Product name ARO-A14680-100
Uniprot ID P18848
Raw Antigen Sequence MTEMSFLSSEVLVGDLMSPFDQSGLGAEESLGLLDDYLEVAKHFKPHGFSSDKAKAGSSEWLAVDGLVSPSNNSKEDAFSGTDWMLEKMDLKEFDLDALLGIDDLETMPDDLLTTLDDTCDLFAPLVQETNKQPPQTVNPIGHLPESLTKPDQVAPFTFLQPLPLSPGVLSSTPDHSFSLELGSEVDITEGDRKPDYTAYVAMIPQCIKEEDTPSDNDSGICMSPESYLGSPQHSPSTRGSPNRSLPSPGVLCGSARPKPYDPPGEKMVAAKVKGEKLDKKLKKMEQNKTAATRYRQKKRAEQEALTGECKELEKKNEALKERADSLAKEIQYLKDLIEEVRKARGKKRVP
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Reference ARO-A14680
Isotype IgG2a
Clonality Monoclonal Antibody
Purification Protein A or G purified from cell culture supernatant.
Immunogen TaxREB67, ATF4, cAMP-dependent transcription factor ATF-4, TXREB, CREB2, cAMP-responsive element-binding protein 2, Tax-responsive enhancer element-binding protein 67, Activating transcription factor 4, CREB-2, Cyclic AMP-dependent transcription factor ATF-4, Cyclic AMP-responsive element-binding protein 2
Target species Anti-Human Monoclonal Antibody
Product name ARO-A14680-1MG
Uniprot ID P18848
Raw Antigen Sequence MTEMSFLSSEVLVGDLMSPFDQSGLGAEESLGLLDDYLEVAKHFKPHGFSSDKAKAGSSEWLAVDGLVSPSNNSKEDAFSGTDWMLEKMDLKEFDLDALLGIDDLETMPDDLLTTLDDTCDLFAPLVQETNKQPPQTVNPIGHLPESLTKPDQVAPFTFLQPLPLSPGVLSSTPDHSFSLELGSEVDITEGDRKPDYTAYVAMIPQCIKEEDTPSDNDSGICMSPESYLGSPQHSPSTRGSPNRSLPSPGVLCGSARPKPYDPPGEKMVAAKVKGEKLDKKLKKMEQNKTAATRYRQKKRAEQEALTGECKELEKKNEALKERADSLAKEIQYLKDLIEEVRKARGKKRVP
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Reference ARO-A14680
Isotype IgG2a
Clonality Monoclonal Antibody
Purification Protein A or G purified from cell culture supernatant.
Immunogen TaxREB67, ATF4, cAMP-dependent transcription factor ATF-4, TXREB, CREB2, cAMP-responsive element-binding protein 2, Tax-responsive enhancer element-binding protein 67, Activating transcription factor 4, CREB-2, Cyclic AMP-dependent transcription factor ATF-4, Cyclic AMP-responsive element-binding protein 2
Target species Anti-Human Monoclonal Antibody
Product name ARO-A14680-50
Uniprot ID P18848
Raw Antigen Sequence MTEMSFLSSEVLVGDLMSPFDQSGLGAEESLGLLDDYLEVAKHFKPHGFSSDKAKAGSSEWLAVDGLVSPSNNSKEDAFSGTDWMLEKMDLKEFDLDALLGIDDLETMPDDLLTTLDDTCDLFAPLVQETNKQPPQTVNPIGHLPESLTKPDQVAPFTFLQPLPLSPGVLSSTPDHSFSLELGSEVDITEGDRKPDYTAYVAMIPQCIKEEDTPSDNDSGICMSPESYLGSPQHSPSTRGSPNRSLPSPGVLCGSARPKPYDPPGEKMVAAKVKGEKLDKKLKKMEQNKTAATRYRQKKRAEQEALTGECKELEKKNEALKERADSLAKEIQYLKDLIEEVRKARGKKRVP
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Reference ARO-A14680
Isotype IgG2a
Clonality Monoclonal Antibody
Purification Protein A or G purified from cell culture supernatant.
Immunogen TaxREB67, ATF4, cAMP-dependent transcription factor ATF-4, TXREB, CREB2, cAMP-responsive element-binding protein 2, Tax-responsive enhancer element-binding protein 67, Activating transcription factor 4, CREB-2, Cyclic AMP-dependent transcription factor ATF-4, Cyclic AMP-responsive element-binding protein 2
Target species Anti-Human Monoclonal Antibody

SDS-PAGE for Anti-Human ATF4/CREB2 Antibody (SAA0818)

SDS-PAGE for Anti-Human ATF4/CREB2 Antibody (SAA0818)

Anti-Human ATF4/CREB2 Antibody (SAA0818), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Anti-Human ATF4/CREB2 Antibody (SAA0818) binds to Recombinant Human ATF4 Protein, N-His in WB Assay

Anti-Human ATF4/CREB2 Antibody (SAA0818) binds to Recombinant Human ATF4 Protein, N-His in WB Assay

Recombinant Human ATF4 Protein, N-His(cat. No.ARO-P15545) can bind Anti-Human ATF4/CREB2 Antibody (SAA0818) in Western Blot Assay as detected on gel analysis.

Anti-Human ATF4/CREB2 Antibody (SAA0818)

There are no reviews yet.

Be the first to review “Anti-Human ATF4/CREB2 Antibody (SAA0818)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products