Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-HPV16 E7/Protein E7 Antibody (Nb2)

Original price was: €378.00.Current price is: €272.00.

50ug 28% OFF + 272 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-HPV16 E7/Protein E7 Antibody (Nb2)

Product name ARO-A15244-100
Uniprot ID P03129
Raw Antigen Sequence MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP
Form 0.01M PBS, pH 7.4.
Delivery condition Dry ice
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human papillomavirus type 16
Reference ARO-A15244
Isotype VHH-mFC
Clonality Monoclonal Antibody
Purification Protein A or G purified from cell culture supernatant.
Immunogen E7, Protein E7, Human Papillomavirus (HPV)
Target species Anti-Human papillomavirus type 16 Monoclonal Antibody
Product name ARO-A15244-1MG
Uniprot ID P03129
Raw Antigen Sequence MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP
Form 0.01M PBS, pH 7.4.
Delivery condition Dry ice
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human papillomavirus type 16
Reference ARO-A15244
Isotype VHH-mFC
Clonality Monoclonal Antibody
Purification Protein A or G purified from cell culture supernatant.
Immunogen E7, Protein E7, Human Papillomavirus (HPV)
Target species Anti-Human papillomavirus type 16 Monoclonal Antibody
Product name ARO-A15244-50
Uniprot ID P03129
Raw Antigen Sequence MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP
Form 0.01M PBS, pH 7.4.
Delivery condition Dry ice
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human papillomavirus type 16
Reference ARO-A15244
Isotype VHH-mFC
Clonality Monoclonal Antibody
Purification Protein A or G purified from cell culture supernatant.
Immunogen E7, Protein E7, Human Papillomavirus (HPV)
Target species Anti-Human papillomavirus type 16 Monoclonal Antibody

SDS-PAGE for Anti-HPV16 E7/Protein E7 Antibody (Nb2)

SDS-PAGE for Anti-HPV16 E7/Protein E7 Antibody (Nb2)

Anti-HPV16 E7/Protein E7 Antibody (Nb2), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Anti-HPV16 E7/Protein E7 Antibody (Nb2)

There are no reviews yet.

Be the first to review “Anti-HPV16 E7/Protein E7 Antibody (Nb2)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products