Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-Bacteriophage 933W stxB2/SLT-2b/VT2 VHH (Nb113)

Clonality:
Monoclonal Antibody
Isotype:
VHH-8His-Cys-tag

379.00

100ug + 379 loyalty points
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-Bacteriophage 933W stxB2/SLT-2b/VT2 VHH (Nb113)

Product name Anti-Bacteriophage 933W stxB2/SLT-2b/VT2 VHH (Nb113)
Uniprot ID P09386
Raw Antigen Sequence MKKMFMAVLFALASVNAMAADCAKGKIEFSKYNEDDTFTVKVDGKEYWTSRWNLQPLLQSAQLTGMTVTIKSSTCESGSGFAEVQFNND
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Aliases /Synonyms Anti-stxB2, Anti-SLT-2b, Anti-VT2
Note For research use only. Not suitable for human use.
Isotype VHH-8His-Cys-tag
Clonality Monoclonal Antibody
Protein Name stxB2

SDS-PAGE for Anti-Bacteriophage 933W stxB2/SLT-2b/VT2 VHH (Nb113)

SDS-PAGE for Anti-Bacteriophage 933W stxB2/SLT-2b/VT2 VHH (Nb113)

Anti-Bacteriophage 933W stxB2/SLT-2b/VT2 VHH (Nb113), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

There are no reviews yet.

Be the first to review “Anti-Bacteriophage 933W stxB2/SLT-2b/VT2 VHH (Nb113)”

Your email address will not be published. Required fields are marked *

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products