Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Alsevalimab Biosimilar – Anti-VTCN1 mAb – Research Grade

  • PX-TA1807-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: €181.00.Current price is: €140.00.

50ug 23% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Alsevalimab Biosimilar - Anti-VTCN1 mAb - Research Grade

Product name Alsevalimab Biosimilar - Anti-VTCN1 mAb - Research Grade
Uniprot ID Q7Z7D3
Species Homo Sapiens
Expression system XtenCHO
Raw Antigen Sequence MASLGQILFWSIISIIIILAGAIALIIGFGISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKNVQLTDAGTYKCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVVWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTESEIKRRSHLQLLNSKASLCVSSFFAISWALLPLSPYLMLK
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Alsevalimab,,VTCN1,anti-VTCN1
Reference PX-TA1807
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1 Kappa
Clonality Monoclonal Antibody
Product name Alsevalimab Biosimilar - Anti-VTCN1 mAb - Research Grade
Uniprot ID Q7Z7D3
Species Homo Sapiens
Expression system XtenCHO
Raw Antigen Sequence MASLGQILFWSIISIIIILAGAIALIIGFGISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKNVQLTDAGTYKCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVVWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTESEIKRRSHLQLLNSKASLCVSSFFAISWALLPLSPYLMLK
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Alsevalimab,,VTCN1,anti-VTCN1
Reference PX-TA1807
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1 Kappa
Clonality Monoclonal Antibody
Product name PX-TA1807-50
Uniprot ID Q7Z7D3
Species Homo Sapiens
Expression system XtenCHO
Raw Antigen Sequence MASLGQILFWSIISIIIILAGAIALIIGFGISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKNVQLTDAGTYKCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVVWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTESEIKRRSHLQLLNSKASLCVSSFFAISWALLPLSPYLMLK
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Alsevalimab,,VTCN1,anti-VTCN1
Reference PX-TA1807
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction to Alsevalimab Biosimilar

Alsevalimab Biosimilar, also known as Anti-VTCN1 mAb, is a monoclonal antibody that is designed to target and bind to a specific protein called V-set domain-containing T cell activation inhibitor 1 (VTCN1). This protein is found on the surface of certain immune cells and plays a role in regulating immune responses. By targeting VTCN1, Alsevalimab Biosimilar has the potential to modulate the immune system and treat various diseases.

Structure of Alsevalimab Biosimilar

Alsevalimab Biosimilar is a recombinant, humanized monoclonal antibody that is produced in a laboratory using genetic engineering techniques. It is designed to have a similar structure to the original antibody, Alsevalimab, which was developed by the biopharmaceutical company AstraZeneca.

The antibody is composed of two identical heavy chains and two identical light chains, each containing a variable region and a constant region. The variable regions are responsible for binding to the target protein, VTCN1, while the constant regions play a role in the antibody’s effector functions.

Alsevalimab Biosimilar also contains a specific modification, known as an Fc region, which is responsible for binding to immune cells and activating them. This modification is important for the antibody’s therapeutic activity.

Mechanism of Action

Alsevalimab Biosimilar works by binding to VTCN1 and blocking its activity. VTCN1 is known to inhibit the activation and function of T cells, which are important immune cells involved in fighting infections and diseases. By blocking VTCN1, Alsevalimab Biosimilar allows T cells to become activated and carry out their normal functions.

In addition, the Fc region of Alsevalimab Biosimilar can also interact with other immune cells, such as natural killer cells and macrophages, to further enhance the immune response. This can lead to the elimination of diseased cells and the suppression of tumor growth.

Therapeutic Applications

Alsevalimab Biosimilar is currently being studied for its potential therapeutic applications in various diseases, including cancer, autoimmune disorders, and infectious diseases.

In cancer, Alsevalimab Biosimilar is being investigated as a potential treatment for solid tumors, such as lung cancer, breast cancer, and melanoma. By activating T cells and enhancing the immune response, the antibody may help to shrink tumors and improve outcomes for cancer patients.

In autoimmune disorders, Alsevalimab Biosimilar may be effective in treating diseases such as rheumatoid arthritis, multiple sclerosis, and psoriasis. By modulating the immune system, the antibody may help to reduce inflammation and alleviate symptoms associated with these conditions.

Furthermore, Alsevalimab Biosimilar may also have potential in treating

infectious diseases, such as viral infections and bacterial infections. By boosting the immune response, the antibody may help the body to fight off these infections more effectively.

Conclusion

In summary, Alsevalimab Biosimilar is a promising monoclonal antibody that targets VTCN1 and has the potential to treat a variety of diseases by modulating the immune system. With ongoing research and clinical trials, it may offer new treatment options for patients with cancer, autoimmune disorders, and infectious diseases.

Disclaimer: This content is for informational purposes only and should not be considered medical advice. Please consult with a healthcare professional for any medical concerns or treatment options.

SDS-PAGE for Alsevalimab Biosimilar - Anti-VTCN1,B7-H4 mAb - Research Grade

SDS-PAGE for Alsevalimab Biosimilar - Anti-VTCN1,B7-H4 mAb - Research Grade

Alsevalimab Biosimilar - Anti-VTCN1,B7-H4 mAb - Research Grade on SDS-PAGE under reducing and non-reducing conditions. The gel was stained overnight with Coomassie Blue.. The purity of the antibody is greater than 95%.

Alsevalimab Biosimilar - Anti-VTCN1;B7-H4 mAb - Research Grade binds to Human VTCN1 recombinant protein in ELISA Assay

Alsevalimab Biosimilar - Anti-VTCN1;B7-H4 mAb - Research Grade binds to Human VTCN1 recombinant protein in ELISA Assay

Human VTCN1 recombinant protein(cat. No.PX-P6477) at 0.5µg/mL (100µL/well) can bind Alsevalimab Biosimilar - Anti-VTCN1;B7-H4 mAb - Research Grade in indirect ELISA with Goat secondary antibody measured by OD450.

Alsevalimab Biosimilar - Anti-VTCN1 mAb - Research Grade

There are no reviews yet.

Be the first to review “Alsevalimab Biosimilar – Anti-VTCN1 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products