Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Alpha-amylase inhibitor 0.19

Host species:
Insect
Uniprot ID:
P01085
Molecular weight:
16.25kDa

Original price was: €265.00.Current price is: €210.00.

50ug 21% OFF + 210 loyalty points
Ser1–Ala124
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Alpha-amylase inhibitor 0.19

Product name Alpha-amylase inhibitor 0.19
Uniprot ID P01085
Uniprot link https://www.uniprot.org/uniprot/P01085
Expression system Eukaryotic expression
Raw Antigen Sequence SGPWMCYPGQAFQVPALPACRPLLRLQCNGSQVPEAVLRDCCQQLAHISEWCRCGALYSMLDSMYKEHGAQEGQAGTGAFPRCRREVVKLTAASITAVCRLPIVVDASGDGAYVCKDVAAYPDA
Molecular weight 16.25kDa
Purity estimated >70% by SDS-PAGE
Buffer PBS, pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Insect
Fragment Type Ser1-Ala124
Aliases /Synonyms 0.19 alpha-AI,0.19 AI,Allergen: Tri a 28
Reference PX-P4285
Note For research use only
Molecular Constructor
Ser1–Ala124
Product name Alpha-amylase inhibitor 0.19
Uniprot ID P01085
Uniprot link https://www.uniprot.org/uniprot/P01085
Expression system Eukaryotic expression
Raw Antigen Sequence SGPWMCYPGQAFQVPALPACRPLLRLQCNGSQVPEAVLRDCCQQLAHISEWCRCGALYSMLDSMYKEHGAQEGQAGTGAFPRCRREVVKLTAASITAVCRLPIVVDASGDGAYVCKDVAAYPDA
Molecular weight 16.25kDa
Purity estimated >70% by SDS-PAGE
Buffer PBS, pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Insect
Fragment Type Ser1-Ala124
Aliases /Synonyms 0.19 alpha-AI,0.19 AI,Allergen: Tri a 28
Reference PX-P4285
Note For research use only
Molecular Constructor
Ser1–Ala124
Product name PX-P4285-1MG
Uniprot ID P01085
Uniprot link https://www.uniprot.org/uniprot/P01085
Expression system Eukaryotic expression
Raw Antigen Sequence SGPWMCYPGQAFQVPALPACRPLLRLQCNGSQVPEAVLRDCCQQLAHISEWCRCGALYSMLDSMYKEHGAQEGQAGTGAFPRCRREVVKLTAASITAVCRLPIVVDASGDGAYVCKDVAAYPDA
Molecular weight 16.25kDa
Purity estimated >70% by SDS-PAGE
Buffer PBS, pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Insect
Fragment Type Ser1-Ala124
Aliases /Synonyms 0.19 alpha-AI,0.19 AI,Allergen: Tri a 28
Reference PX-P4285
Note For research use only
Molecular Constructor
Ser1–Ala124

Alpha-amylase inhibitor 0.19

There are no reviews yet.

Be the first to review “Alpha-amylase inhibitor 0.19”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products