Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Adalimumab Biosimilar – Anti-TNF alpha mAb – Research Grade

Isotype:
IgG1

Original price was: €102.00.Current price is: €84.00.

50ug 18% OFF + 84 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Adalimumab Biosimilar - Anti-TNF alpha mAb - Research Grade

Product name PX-TA1001-50
Uniprot ID P01375
Source DrugBank DB00051
Species Human
Expression system Mammalian
Raw Antigen Sequence MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Molecular weight 144kDa
Purity >85%
Buffer PBS pH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms Adalimumab,Adalimumab,TNF alpha,anti-TNF alpha
Reference PX-TA1001
Note For research use only. Not suitable for human use.
Isotype IgG1
Product name Adalimumab Biosimilar - Anti-TNF alpha mAb - Research Grade
Uniprot ID P01375
Source DrugBank DB00051
Species Human
Expression system Mammalian
Raw Antigen Sequence MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Molecular weight 144kDa
Purity >85%
Buffer PBS pH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms Adalimumab,Adalimumab,TNF alpha,anti-TNF alpha
Reference PX-TA1001
Note For research use only. Not suitable for human use.
Isotype IgG1
Product name Adalimumab Biosimilar - Anti-TNF alpha mAb - Research Grade
Uniprot ID P01375
Source DrugBank DB00051
Species Human
Expression system Mammalian
Raw Antigen Sequence MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Molecular weight 144kDa
Purity >85%
Buffer PBS pH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms Adalimumab,Adalimumab,TNF alpha,anti-TNF alpha
Reference PX-TA1001
Note For research use only. Not suitable for human use.
Isotype IgG1
Product name Adalimumab Biosimilar - Anti-TNF alpha mAb - Research Grade
Uniprot ID P01375
Source DrugBank DB00051
Species Human
Expression system Mammalian
Raw Antigen Sequence MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Molecular weight 144kDa
Purity >85%
Buffer PBS pH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Adalimumab,Adalimumab,TNF alpha,anti-TNF alpha
Reference PX-TA1001
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1
Clonality Monoclonal Antibody
Product name Adalimumab Biosimilar - Anti-TNF alpha mAb - Research Grade
Uniprot ID P01375
Source DrugBank DB00051
Species Human
Expression system Mammalian cells
Raw Antigen Sequence MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Molecular weight 144kDa
Purity >85%
Buffer PBS pH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Adalimumab,Adalimumab,TNF alpha,anti-TNF alpha
Reference PX-TA1001
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1
Clonality Monoclonal Antibody

General information about Adalimumab

Adalimumab is a recombinant, human IgG1 monoclonal antibody directed against tumor necrosis factor-alpha (TNF-alpha), with immunomodulating activity. Upon administration, adalimumab binds to TNF-alpha, thereby preventing its binding to the p55 and p75 TNF cell surface receptors and inhibiting TNF-mediated immune responses. TNF-alpha, a pro-inflammatory cytokine, is upregulated in various autoimmune diseases.

Adalimumab Biosimilar - Anti-TNF alpha mAb binds to Human TNFa/TNF-alpha in indirect ELISA Assay

Adalimumab Biosimilar - Anti-TNF alpha mAb binds to Human TNFa/TNF-alpha in indirect ELISA Assay

Immobilized Human TNFa Recombinant Protein (cat. No.PX-P3058) at 0.5µg/mL (100µL/well) can bind Adalimumab Biosimilar - Anti-TNF alpha mAb (cat. No.PX-TA1001) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 142.1M.

SDS-PAGE for Adalimumab Biosimilar - Anti-TNF alpha mAb

SDS-PAGE for Adalimumab Biosimilar - Anti-TNF alpha mAb

Adalimumab Biosimilar - Anti-TNF alpha mAb, on SDS-PAGE under reducing and non-reducing condition. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Adalimumab Biosimilar - Anti-TNF alpha mAb - Research Grade

  • Ofer Gover — December 14, 2021

    We used this ab to reduce as a negative control for reducing caco-2 (IEC) cells exitation by exugenues TNFa. We measured IL8 secreation as a result of TNFa stimulation. 1ug/mL ofAdalimumab Biosimilar – Anti-TNF alpha mAb was enough to completly abolish IL8 secreation by TNFa stimulation in caco-2 cells.

Add a review

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products