Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human CD85a-LILRB3 recombinant protein

  • PX-P6158
  • Validated ELISA
Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
O75022
Molecular weight:
49.49 kDa

319.00

100ug + 319 loyalty points
Met1–Glu443 His
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Human CD85a-LILRB3 recombinant protein

Product name Human CD85a-LILRB3 recombinant protein
Uniprot ID O75022
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MTPALTALLCLGLSLGPRTRVQAGPFPKPTLWAEPGSVISWGSPVTIWCQGSQEAQEYRLHKEGSPEPLDRNNPLEPKNKARFSIPSMTEHHAGRYRCHYYSSAGWSEPSDPLEMVMTGAYSKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSRGFQALFPVGPVTPSHRWRFTCYYYYTNTPWVWSHPSDPLEILPSGVSRKPSLLTLQGPVLAPGQSLTLQCGSDVGYNRFVLYKEGERDFLQRPGQQPQAGLSQANFTLGPVSPSNGGQYRCYGAHNLSSEWSAPSDPLNILMAGQIYDTVSLSAQPGPTVASGENVTLLCQSWWQFDTFLLTKEGAAHPPLRLRSMYGAHKYQAEFPMSPVTSAHAGTYRCYGSYSSNPHLLSHPSEPLELVVSGHSGGSSLPPTGPPSTPGLGRYLE
Molecular weight 49.49 kDa
Protein delivered with Tag? C-Terminal His Tag
Purity estimated >85% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4.
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Glu443
Aliases /Synonyms CD85a, ILT-5, Monocyte inhibitory receptor HL9, LILRB3, Immunoglobulin-like transcript 5, CD85 antigen-like family member A, ILT5, Leukocyte immunoglobulin-like receptor 3, LIR-3, Leukocyte immunoglobulin-like receptor subfamily B member 3, LIR3
Reference PX-P6158
Note For research use only
Molecular Constructor
Met1–Glu443 His

Anti-Human CD85a/LILRB3 Antibody (SAA2377) binds to Human CD85a-LILRB3 recombinant protein in ELISA assay

Anti-Human CD85a/LILRB3 Antibody (SAA2377) binds to Human CD85a-LILRB3 recombinant protein in ELISA assay

Immobilized Human CD85a-LILRB3 recombinant protein (cat. No.PX-P6158) at 0.5µg/mL (100µL/well) can bind Anti-Human CD85a/LILRB3 Antibody (SAA2377) (cat. No.ARO-A22786 ) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 114.9M.

Human CD85a-LILRB3 recombinant protein

There are no reviews yet.

Be the first to review “Human CD85a-LILRB3 recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products