Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Acidic phospholipase A2 CoaPLA2

Host species:
Escherichia coli (E.coli)
Uniprot ID:
Q7ZTA7
Molecular weight:
16.94 kDa

Original price was: €250.00.Current price is: €210.00.

50ug 16% OFF + 210 loyalty points
Leu18–Cys139
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Acidic phospholipase A2 CoaPLA2

Product name Acidic phospholipase A2 CoaPLA2
Uniprot ID Q7ZTA7
Uniprot link https://www.uniprot.org/uniprot/Q7ZTA7
Expression system Prokaryotic expression
Raw Antigen Sequence MGYLLPTAAAGLLLLAAQPAMADLIQFDMMILKVAKRSAMFSYSAYGCYCGWGGHGKPQDPTDRCCLVHDCCYGKVTDCDPKFGSYTYSMNDGALVCGGDDPCKKQVCECDKAAAICFRDNLDTYDYDTYWRFPPKNCLEESEPCGSHHHHHH
Molecular weight 16.94 kDa
Purity estimated /
Buffer 20mMTris-HCl,pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu18-Cys139
Aliases /Synonyms svPLA2,Cvv-E6d,Phosphatidylcholine 2-acylhydrolase
Reference PX-P4330
Note For research use only
Molecular Constructor
Leu18–Cys139
Product name Acidic phospholipase A2 CoaPLA2
Uniprot ID Q7ZTA7
Uniprot link https://www.uniprot.org/uniprot/Q7ZTA7
Expression system Prokaryotic expression
Raw Antigen Sequence MGYLLPTAAAGLLLLAAQPAMADLIQFDMMILKVAKRSAMFSYSAYGCYCGWGGHGKPQDPTDRCCLVHDCCYGKVTDCDPKFGSYTYSMNDGALVCGGDDPCKKQVCECDKAAAICFRDNLDTYDYDTYWRFPPKNCLEESEPCGSHHHHHH
Molecular weight 16.94 kDa
Purity estimated /
Buffer 20mMTris-HCl,pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu18-Cys139
Aliases /Synonyms svPLA2,Cvv-E6d,Phosphatidylcholine 2-acylhydrolase
Reference PX-P4330
Note For research use only
Molecular Constructor
Leu18–Cys139
Product name PX-P4330-1MG
Uniprot ID Q7ZTA7
Uniprot link https://www.uniprot.org/uniprot/Q7ZTA7
Expression system Prokaryotic expression
Raw Antigen Sequence MGYLLPTAAAGLLLLAAQPAMADLIQFDMMILKVAKRSAMFSYSAYGCYCGWGGHGKPQDPTDRCCLVHDCCYGKVTDCDPKFGSYTYSMNDGALVCGGDDPCKKQVCECDKAAAICFRDNLDTYDYDTYWRFPPKNCLEESEPCGSHHHHHH
Molecular weight 16.94 kDa
Purity estimated /
Buffer 20mMTris-HCl,pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu18-Cys139
Aliases /Synonyms svPLA2,Cvv-E6d,Phosphatidylcholine 2-acylhydrolase
Reference PX-P4330
Note For research use only
Molecular Constructor
Leu18–Cys139

Acidic phospholipase A2 CoaPLA2

There are no reviews yet.

Be the first to review “Acidic phospholipase A2 CoaPLA2”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products