Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Zebrafish slc2a10 Recombinant Protein, N-GST & C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Zebrafish
Uniprot ID:
F1R0H0

Original price was: €269.00.Current price is: €228.00.

50ug 15% OFF + 228 loyalty points
GST Arg323–Lys376 His
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Zebrafish slc2a10 Recombinant Protein, N-GST & C-His

Product name ARO-P17893-100
Uniprot ID F1R0H0
Origin species Zebrafish
Expression system Prokaryotic expression
Raw Antigen Sequence RQSVIDTTKRCTSVGPHSNLTLSAEHDEGVGFSSQTLDVHEHLRSFSQSEDIYK
Protein delivered with Tag? N-Terminal GST and C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg323-Lys376
Aliases /Synonyms Solute carrier family 2 facilitated glucose transporter member 10, Glucose transporter type 10, GLUT-10, slc2a10
Reference ARO-P17893
Note For research use only.
Molecular Constructor
GST Arg323–Lys376 His
Product name ARO-P17893-1MG
Uniprot ID F1R0H0
Origin species Zebrafish
Expression system Prokaryotic expression
Raw Antigen Sequence RQSVIDTTKRCTSVGPHSNLTLSAEHDEGVGFSSQTLDVHEHLRSFSQSEDIYK
Protein delivered with Tag? N-Terminal GST and C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg323-Lys376
Aliases /Synonyms Solute carrier family 2 facilitated glucose transporter member 10, Glucose transporter type 10, GLUT-10, slc2a10
Reference ARO-P17893
Note For research use only.
Molecular Constructor
GST Arg323–Lys376 His
Product name ARO-P17893-50
Uniprot ID F1R0H0
Origin species Zebrafish
Expression system Prokaryotic expression
Raw Antigen Sequence RQSVIDTTKRCTSVGPHSNLTLSAEHDEGVGFSSQTLDVHEHLRSFSQSEDIYK
Protein delivered with Tag? N-Terminal GST and C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg323-Lys376
Aliases /Synonyms Solute carrier family 2 facilitated glucose transporter member 10, Glucose transporter type 10, GLUT-10, slc2a10
Reference ARO-P17893
Note For research use only.
Molecular Constructor
GST Arg323–Lys376 His

There are no reviews yet.

Be the first to review “Zebrafish slc2a10 Recombinant Protein, N-GST & C-His”

Your email address will not be published. Required fields are marked *

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products