Cart (0 Items)
Your cart is currently empty.
View Products-
-
-
Zea mays ASR1 Recombinant Protein
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Escherichia coli (E. coli) |
| Applications | Elisa, WB |
| Product name | Zea mays ASR1 Recombinant Protein |
|---|---|
| Uniprot ID | D1MN58 |
| Uniprot link | http://www.uniprot.org/uniprot/D1MN58 |
| Origin species | Zea mays |
| Expression system | Prokaryotic expression |
| Sequence | MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHN MLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALD VVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSMAEEKHHHH HLFHHKKDEEQEEQLAGGGYGESAEYTEATVTEVVSTGENEYDEYKEEKQHKHKQHLGEAGAIAAGAFALYEKHEAKKDP EHAHRHKIEEEVAAAAAVGSGGFAFHEHHEKKKDHKDAEEAGGEKKHHFFG |
| Molecular weight | 42,53 kDa |
| Protein delivered with Tag? | No |
| Purity estimated | 80% (with degraded bands) |
| Buffer | 3C-protease cleavage buffer: TrisHC 50mMl, NaCl 150mM, EDTA 1mM, DTT 1mM, pH7 |
| Form | liquid |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 2-3 |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Full-length |
| Protein Accession | CAA72998.1 |
| Spec:SwissProtID | D1MN58 |
| NCBI Reference | CAA72998.1 |
| Aliases /Synonyms | ASR1, ABA-, stress-and fruit-ripening inducible-like protein |
| Reference | PX-P1053 |
| Note | For research use only |
Contact us
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.