Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Xenopus rtTA Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
Xenopus
Molecular weight:
30,56 kDa

€210.00

50ug + 210 loyalty points
Full-length
size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Xenopus rtTA Recombinant Protein

Xenopus rtTA Recombinant Protein

Product name Xenopus rtTA Recombinant Protein
Origin species Xenopus
Expression system Prokaryotic expression
Raw Antigen Sequence MGHHHHHHHHHHSSGHIDDDDKHNMSRLDKSKVINGALELLNGVGIEGLTTRKLAQKLGVEQPTLYWHVKNKRALLDALP IEMLDRHHTHFCPLEGESWQDFLRNNAKSFRCALLSHRDGAKVHLGTRPTEKQYETLENQLAFLCQQGFSLENALYALSA VGHFTLGCVLEEQEHQVAKEERETPTTDSMPPLLRQAIELFDRQGAEPAFLFGLELIICGLEKQLKCESGGPADALDDFD LDMLPADALDDFDLDMLPADALDDFDLDMLPG
Molecular weight 30,56 kDa
Purity estimated 90%
Buffer PBS, imidazole 400mM
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Full-length
Protein Accession ABC65842.1
NCBI Reference ABC65842.1
Aliases /Synonyms rtTA, rtTA-M2.alt [Expression vector peTetOn(PacI)], doxycycline-activated transcriptional activator
Reference PX-P1148
Note For research use only
Molecular Constructor
Full-length
Product name Xenopus rtTA Recombinant Protein
Origin species Xenopus
Expression system Prokaryotic expression
Raw Antigen Sequence MGHHHHHHHHHHSSGHIDDDDKHNMSRLDKSKVINGALELLNGVGIEGLTTRKLAQKLGVEQPTLYWHVKNKRALLDALP IEMLDRHHTHFCPLEGESWQDFLRNNAKSFRCALLSHRDGAKVHLGTRPTEKQYETLENQLAFLCQQGFSLENALYALSA VGHFTLGCVLEEQEHQVAKEERETPTTDSMPPLLRQAIELFDRQGAEPAFLFGLELIICGLEKQLKCESGGPADALDDFD LDMLPADALDDFDLDMLPADALDDFDLDMLPG
Molecular weight 30,56 kDa
Purity estimated 90%
Buffer PBS, imidazole 400mM
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Full-length
Protein Accession ABC65842.1
NCBI Reference ABC65842.1
Aliases /Synonyms rtTA, rtTA-M2.alt [Expression vector peTetOn(PacI)], doxycycline-activated transcriptional activator
Reference PX-P1148
Note For research use only
Molecular Constructor
Full-length

General information on Xenopus rtTA Recombinant Protein

Fusion protein of reverse tetracycline repressor protein and immediate early protein 1 activation domain. Used in Tetracycline repressor-regulated gene repression experiments.

  • Bäckman CM, Zhang Y, Hoffer BJ, Tomac AC. Tetracycline-inducible expression systems for the generation of transgenic animals: a comparison of various inducible systems carried in a single vector. J Neurosci Methods. 2004 Oct 30;139(2):257-62. PubMed PMID: 15488239, https://doi.org/10.1016/j.jneumeth.2004.05.012

There are no reviews yet.

Be the first to review “Xenopus rtTA Recombinant Protein”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products