Xenopus rtTA Recombinant Protein

Reference:
Size

10ug, 100ug

Brand

Product type

Host Species

Product nameXenopus rtTA Recombinant Protein
Origin speciesXenopus
Expression systemProcaryotic expression
SequenceMGHHHHHHHHHHSSGHIDDDDKHNMSRLDKSKVINGALELLNGVGIEGLTTRKLAQKLGVEQPTLYWHVKNKRALLDALP IEMLDRHHTHFCPLEGESWQDFLRNNAKSFRCALLSHRDGAKVHLGTRPTEKQYETLENQLAFLCQQGFSLENALYALSA VGHFTLGCVLEEQEHQVAKEERETPTTDSMPPLLRQAIELFDRQGAEPAFLFGLELIICGLEKQLKCESGGPADALDDFD LDMLPADALDDFDLDMLPADALDDFDLDMLPG
Molecular weight30,56 kDa
Purity estimated90%
BufferPBS, imidazole 400mM
Formliquid
Delivery conditionDry Ice
Delivery lead time in business days10-25
Storage condition4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
BrandProteoGenix
Host speciesEscherichia coli (E.coli)
Fragment TypeFull-length
Protein AccessionABC65842.1
NCBI ReferenceABC65842.1
Aliases /SynonymsrtTA, rtTA-M2.alt [Expression vector peTetOn(PacI)], doxycycline-activated transcriptional activator
ReferencePX-P1148
Publications1: Bäckman CM, Zhang Y, Hoffer BJ, Tomac AC. Tetracycline-inducible expression systems for the generation of transgenic animals: a comparison of various inducible systems carried in a single vector. J Neurosci Methods. 2004 Oct 30;139(2):257-62. PubMed PMID: 15488239.
NoteFor research use only

General information on Xenopus rtTA Recombinant Protein

Fusion protein of reverse tetracycline repressor protein and immediate early protein 1 activation domain. Used in Tetracycline repressor-regulated gene repression experiments.

Publication

1: Bäckman CM, Zhang Y, Hoffer BJ, Tomac AC. Tetracycline-inducible expression systems for the generation of transgenic animals: a comparison of various inducible systems carried in a single vector. J Neurosci Methods. 2004 Oct 30;139(2):257-62. PubMed PMID: 15488239.

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Xenopus rtTA Recombinant Protein”

Your email address will not be published. Required fields are marked *

Contact us

Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.