Wheat TAGW2 Recombinant Protein

Reference:
Size

10ug, 100ug

Brand

Product type

Host Species

Product nameWheat TAGW2 Recombinant Protein
Uniprot IDE5LBR8
Uniprot linkhttp://www.uniprot.org/uniprot/E5LBR8
Origin speciesWheat
Expression systemProcaryotic expression
SequenceMSYYHHHHHHLESTSLYKKAGFMGNRIGGRRKAGVEERYTRPQGLYEHRDIDQKKLRKLILEAKLAPCYPGADDAAGGDL EECPICFLYYPSLNRSKCCSKGICTECFLQMKPTHTARPTQCPFCKTPNYAVEYRGVKTKEERSIEQFEEQKVIEAQMRV RQQALQDEEDKMKRKQSRCSSSRTIAPTTEVEYRDICSTSYSVPSYQCTQQETECCSSEPSCSAQANMRSFHSRHTRDDN IDMNIEDMMVMEAIWRSIQEQGSIGNPSCGSFMPFEQPTRERQAFVAAPPLEIPHPGGFSCAVAAMAEHQPSSMDFSYMT GSSAFPVFDMFRRPCNIAGGSMGAVESSPDSWSGIAPSCSRREVVREEGECSTDHWSEGAEAGTSYAGSDIVVDAGTMLP LPFADNYSMVASHFRPESIEEQMMYSMAVSLAEAHGRTHSQGLAWL
Molecular weight49,94 kDa
Purity estimated90%
BufferPBS, imidazole 150mM, Urea 4M if denaturing conditions. PBS, imidazole 150mM if renaturation.
Formliquid
Delivery conditionDry Ice
Delivery lead time in business days10-25
Storage condition4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
BrandProteoGenix
Host speciesEscherichia coli (E.coli)
Fragment TypeFull-length
Protein AccessionADQ00387.1
Spec:SwissProtIDE5LBR8
NCBI ReferenceADQ00387.1
Aliases /SynonymsTAGW2, ring E3 ubiquitin ligase, REUL1
ReferencePX-P1159
Publications1: Yang Z, Bai Z, Li X, Wang P, Wu Q, Yang L, Li L, Li X. SNP identification and allelic-specific PCR markers development for TaGW2, a gene linked to wheat kernel weight. Theor Appl Genet. 2012 Sep;125(5):1057-68. doi: 10.1007/s00122-012-1895-6. Epub 2012 May 29. PubMed PMID: 22643902.
NoteFor research use only

General information on Wheat TAGW2 Recombinant Protein

Wheat orthologous gene of rice OsGW2 that negatively regulates the grain width and weight in rice. There are three TaGW2 homologs in bread wheat, TaGW2A, TaGW2B, and TaGW2D. The transcript abundance of TaGW2A is negatively associated with the grain width.

Publication

1: Yang Z, Bai Z, Li X, Wang P, Wu Q, Yang L, Li L, Li X. SNP identification and allelic-specific PCR markers development for TaGW2, a gene linked to wheat kernel weight. Theor Appl Genet. 2012 Sep;125(5):1057-68. doi: 10.1007/s00122-012-1895-6. Epub 2012 May 29. PubMed PMID: 22643902.

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Wheat TAGW2 Recombinant Protein”

Your email address will not be published. Required fields are marked *

Contact us

Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.