Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

🚀 Special Offer🚀Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

📢 New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Brand: ProteoGenix

Wheat TAGW2 Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
Wheat
Uniprot ID:
E5LBR8
Molecular weight:
49,94 kDa

€210.00

+ 210 loyalty points
Full-length
size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Wheat TAGW2 Recombinant Protein

Wheat TAGW2 Recombinant Protein

Product name Wheat TAGW2 Recombinant Protein
Uniprot ID E5LBR8
Uniprot link http://www.uniprot.org/uniprot/E5LBR8
Origin species Wheat
Expression system Prokaryotic expression
Sequence MSYYHHHHHHLESTSLYKKAGFMGNRIGGRRKAGVEERYTRPQGLYEHRDIDQKKLRKLILEAKLAPCYPGADDAAGGDL EECPICFLYYPSLNRSKCCSKGICTECFLQMKPTHTARPTQCPFCKTPNYAVEYRGVKTKEERSIEQFEEQKVIEAQMRV RQQALQDEEDKMKRKQSRCSSSRTIAPTTEVEYRDICSTSYSVPSYQCTQQETECCSSEPSCSAQANMRSFHSRHTRDDN IDMNIEDMMVMEAIWRSIQEQGSIGNPSCGSFMPFEQPTRERQAFVAAPPLEIPHPGGFSCAVAAMAEHQPSSMDFSYMT GSSAFPVFDMFRRPCNIAGGSMGAVESSPDSWSGIAPSCSRREVVREEGECSTDHWSEGAEAGTSYAGSDIVVDAGTMLP LPFADNYSMVASHFRPESIEEQMMYSMAVSLAEAHGRTHSQGLAWL
Molecular weight 49,94 kDa
Purity estimated 90%
Buffer PBS, imidazole 150mM, Urea 4M if denaturing conditions. PBS, imidazole 150mM if renaturation.
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Full-length
Protein Accession ADQ00387.1
Spec:SwissProtID E5LBR8
NCBI Reference ADQ00387.1
Aliases /Synonyms TAGW2, ring E3 ubiquitin ligase, REUL1
Reference PX-P1159
Note For research use only
Molecular Constructor
Full-length
Product name Wheat TAGW2 Recombinant Protein
Uniprot ID E5LBR8
Uniprot link http://www.uniprot.org/uniprot/E5LBR8
Origin species Wheat
Expression system Prokaryotic expression
Sequence MSYYHHHHHHLESTSLYKKAGFMGNRIGGRRKAGVEERYTRPQGLYEHRDIDQKKLRKLILEAKLAPCYPGADDAAGGDL EECPICFLYYPSLNRSKCCSKGICTECFLQMKPTHTARPTQCPFCKTPNYAVEYRGVKTKEERSIEQFEEQKVIEAQMRV RQQALQDEEDKMKRKQSRCSSSRTIAPTTEVEYRDICSTSYSVPSYQCTQQETECCSSEPSCSAQANMRSFHSRHTRDDN IDMNIEDMMVMEAIWRSIQEQGSIGNPSCGSFMPFEQPTRERQAFVAAPPLEIPHPGGFSCAVAAMAEHQPSSMDFSYMT GSSAFPVFDMFRRPCNIAGGSMGAVESSPDSWSGIAPSCSRREVVREEGECSTDHWSEGAEAGTSYAGSDIVVDAGTMLP LPFADNYSMVASHFRPESIEEQMMYSMAVSLAEAHGRTHSQGLAWL
Molecular weight 49,94 kDa
Purity estimated 90%
Buffer PBS, imidazole 150mM, Urea 4M if denaturing conditions. PBS, imidazole 150mM if renaturation.
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Full-length
Protein Accession ADQ00387.1
Spec:SwissProtID E5LBR8
NCBI Reference ADQ00387.1
Aliases /Synonyms TAGW2, ring E3 ubiquitin ligase, REUL1
Reference PX-P1159
Note For research use only
Molecular Constructor
Full-length

General information on Wheat TAGW2 Recombinant Protein

Wheat orthologous gene of rice OsGW2 that negatively regulates the grain width and weight in rice. There are three TaGW2 homologs in bread wheat, TaGW2A, TaGW2B, and TaGW2D. The transcript abundance of TaGW2A is negatively associated with the grain width.

  • Yang Z, Bai Z, Li X, Wang P, Wu Q, Yang L, Li L, Li X. SNP identification and allelic-specific PCR markers development for TaGW2, a gene linked to wheat kernel weight. Theor Appl Genet. 2012 Sep;125(5):1057-68. doi: https://doi.org/10.1007/s00122-012-1895-6. Epub 2012 May 29. PubMed PMID: 22643902.

There are no reviews yet.

Be the first to review “Wheat TAGW2 Recombinant Protein”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products