Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Vopratelimab Biosimilar – Anti-ICOS, CD278 mAb – Research Grade

  • PX-TA1505-50
  • Validated ELISA FC WB
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: €186.00.Current price is: €140.00.

50ug 25% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Vopratelimab Biosimilar - Anti-ICOS, CD278 mAb - Research Grade

Product name Vopratelimab Biosimilar - Anti-ICOS, CD278 mAb - Research Grade
Uniprot ID Q9Y6W8
Source CAS 2039148-04-2
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MKSGLWYFFLFCLRIKVLTGEINGSANYEMFIFHNGGVQILCKYPDIVQQFKMQLLKGGQILCDLTKTKGSGNTVSIKSLKFCHSQLSNNSVSFFLYNLDHSHANYYFCNLSIFDPPPFKVTLTGGYLHIYESQLCCQLKFWLPIGCAAFVVVCILGCILICWLTKKKYSSSVHDPNGEYMFMRAVNTAKKSRLTDVTL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Vopratelimab,JTX-2011,ICOS, CD278,anti-ICOS, CD278
Reference PX-TA1505
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Vopratelimab Biosimilar - Anti-ICOS, CD278 mAb - Research Grade
Uniprot ID Q9Y6W8
Source CAS 2039148-04-2
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MKSGLWYFFLFCLRIKVLTGEINGSANYEMFIFHNGGVQILCKYPDIVQQFKMQLLKGGQILCDLTKTKGSGNTVSIKSLKFCHSQLSNNSVSFFLYNLDHSHANYYFCNLSIFDPPPFKVTLTGGYLHIYESQLCCQLKFWLPIGCAAFVVVCILGCILICWLTKKKYSSSVHDPNGEYMFMRAVNTAKKSRLTDVTL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Vopratelimab,JTX-2011,ICOS, CD278,anti-ICOS, CD278
Reference PX-TA1505
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1505-50
Uniprot ID Q9Y6W8
Source CAS 2039148-04-2
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MKSGLWYFFLFCLRIKVLTGEINGSANYEMFIFHNGGVQILCKYPDIVQQFKMQLLKGGQILCDLTKTKGSGNTVSIKSLKFCHSQLSNNSVSFFLYNLDHSHANYYFCNLSIFDPPPFKVTLTGGYLHIYESQLCCQLKFWLPIGCAAFVVVCILGCILICWLTKKKYSSSVHDPNGEYMFMRAVNTAKKSRLTDVTL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Vopratelimab,JTX-2011,ICOS, CD278,anti-ICOS, CD278
Reference PX-TA1505
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction

Vopratelimab Biosimilar, also known as Anti-ICOS or CD278 mAb, is a monoclonal antibody that has been developed as a potential therapeutic agent for various diseases. This biosimilar is a promising candidate for targeting the immune checkpoint protein ICOS (Inducible T-cell CO-Stimulator) and has shown great potential in preclinical studies. In this article, we will discuss the structure, activity, and potential applications of Vopratelimab Biosimilar.

Structure of Vopratelimab Biosimilar

Vopratelimab Biosimilar is a recombinant humanized monoclonal antibody that has been designed to mimic the structure and function of the natural human antibody. It is composed of two heavy chains and two light chains, which are connected by disulfide bonds. The heavy chains consist of four constant domains (CH1, CH2, CH3, and CH4) and one variable domain (VH), while the light chains consist of two constant domains (CL) and one variable domain (VL). The variable domains are responsible for binding to the target protein, ICOS, while the constant domains provide stability and effector functions.

Activity of Vopratelimab Biosimilar

Vopratelimab Biosimilar exerts its activity by specifically binding to the ICOS protein on the surface of T-cells. ICOS is a co-stimulatory molecule that plays a crucial role in regulating T-cell activation and function. By binding to ICOS, Vopratelimab Biosimilar blocks its interaction with its ligand, resulting in the inhibition of T-cell activation and proliferation. This, in turn, leads to the suppression of immune responses, making Vopratelimab Biosimilar a potential immunomodulatory agent.

In addition to its inhibitory effect on T-cells, Vopratelimab Biosimilar has also been shown to have other immunomodulatory functions. It has been reported to induce the production of regulatory T-cells, which are important in maintaining immune homeostasis and preventing autoimmune diseases. Moreover, Vopratelimab Biosimilar has been found to enhance the activity of natural killer cells, which are important in killing virus-infected and cancerous cells.

Potential Applications of Vopratelimab Biosimilar

Vopratelimab Biosimilar has shown great potential in preclinical studies for the treatment of various diseases. Its ability to inhibit T-cell activation and proliferation makes it a promising candidate for the treatment of autoimmune diseases, such as rheumatoid arthritis, multiple sclerosis, and lupus. Furthermore, its immunomodulatory effects make it a potential therapeutic agent for cancer, as it can enhance the immune response against cancer cells.

In addition to its potential as a therapeutic agent, Vopratelimab Biosimilar also has research applications. It can be used as a tool for studying the role of ICOS in immune responses and for investigating the potential of targeting ICOS as a treatment strategy for various diseases. Vopratelimab Biosimilar can also be used as a positive control in experiments involving ICOS, as it has a known and specific binding affinity for the protein.

Conclusion

In summary, Vopratelimab Biosimilar, also known as Anti-ICOS or CD278 mAb, is a recombinant humanized monoclonal antibody that specifically binds to the immune checkpoint protein ICOS. It exerts its activity by inhibiting T-cell activation and proliferation, as well as inducing the production of regulatory T-cells and enhancing the activity of natural killer cells. Vopratelimab Biosimilar has shown great potential in preclinical studies for the treatment of autoimmune diseases and cancer, as well as research applications. Further clinical trials are needed to fully evaluate the efficacy and safety of this promising biosimilar.

SEC-HPLC of Vopratelimab Biosimilar - Anti-CD278;ICOS mAb - Research Grade

SEC-HPLC of Vopratelimab Biosimilar - Anti-CD278;ICOS mAb - Research Grade

Vopratelimab Biosimilar - Anti-CD278;ICOS mAb - Research Gradewas analyzed by size exclusion chromatography with UV detection.

Flow Cytometry results for Vopratelimab Biosimilar - Anti-CD278;ICOS mAb - Research Grade

Flow Cytometry results for Vopratelimab Biosimilar - Anti-CD278;ICOS mAb - Research Grade

Target Cells were stained with an irrelevant antibody or Vopratelimab Biosimilar - Anti-CD278;ICOS mAb - Research Grade at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using Goat Anti-Human IgG Polyclonal Antibody, FITC (PTX18862) and cells analysed on a NovoCyte Flow Cytometer.

Vopratelimab Biosimilar - Anti-ICOS, CD278 mAb - Research Grade

There are no reviews yet.

Be the first to review “Vopratelimab Biosimilar – Anti-ICOS, CD278 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products