Name: Volume-regulated anion channel subunit LRRC8D (Lrrc8d)
SKU: PX-P4696-10
Availability: InStock

Product name	Volume-regulated anion channel subunit LRRC8D (Lrrc8d)
Uniprot ID	Q5U308
Uniprot link	https://www.uniprot.org/uniprot/Q5U308
Expression system	Prokaryotic expression
Sequence	MGPEAKIPAKISQMTNLQELHLCHCPAKVEQTAFSFLRDHLRCLHVKFTDVAEIPAWVYLLKNLRELYLIGNLNSENNKMIGLESLRELRHLKILHVKSNLTKVPSNITDVAPHLGSHHHHHH
Molecular weight	14.1kDa
Protein delivered with Tag?	C-terminal His Tag
Purity estimated	>75% by SDS-PAGE
Buffer	PBS, pH7.5
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Applications	ELISA,WB
Fragment Type	Pro501-Leu613
Protein Accession	Q5U308
Spec:Entrez GeneID	305131
Spec:SwissProtID	Q5U308
NCBI Reference	Q5U308
Aliases /Synonyms	Leucine-rich repeat-containing protein 5,Leucine-rich repeat-containing protein 8D,Lrrc5
Reference	PX-P4696
Note	For research use only

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Volume-regulated anion channel subunit LRRC8D (Lrrc8d)”

Size

Clear

Please select the country of delivery so that we can send you the quotation including shipping costs.

Thank you for your request! You will receive your quotation per e-mail in a few seconds.

If you did not receive your quotation, please check your spam folder.

Contact us

PTX17851 180€

View product

Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.