Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Volume-regulated anion channel subunit LRRC8D (Lrrc8d)

Host species:
Escherichia coli (E.coli)
Uniprot ID:
Q5U308
Molecular weight:
14.1kDa

210.00

50ug + 210 loyalty points
Pro501–Leu613 His
size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Volume-regulated anion channel subunit LRRC8D (Lrrc8d)

Product name Volume-regulated anion channel subunit LRRC8D (Lrrc8d)
Uniprot ID Q5U308
Uniprot link https://www.uniprot.org/uniprot/Q5U308
Expression system Prokaryotic expression
Raw Antigen Sequence PEAKIPAKISQMTNLQELHLCHCPAKVEQTAFSFLRDHLRCLHVKFTDVAEIPAWVYLLKNLRELYLIGNLNSENNKMIGLESLRELRHLKILHVKSNLTKVPSNITDVAPHL
Molecular weight 14.1kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >75% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Pro501-Leu613
Protein Accession Q5U308
Spec:Entrez GeneID 305131
Spec:SwissProtID Q5U308
NCBI Reference Q5U308
Aliases /Synonyms Leucine-rich repeat-containing protein 5,Leucine-rich repeat-containing protein 8D,Lrrc5
Reference PX-P4696
Note For research use only
Molecular Constructor
Pro501–Leu613 His
Product name Volume-regulated anion channel subunit LRRC8D (Lrrc8d)
Uniprot ID Q5U308
Uniprot link https://www.uniprot.org/uniprot/Q5U308
Expression system Prokaryotic expression
Raw Antigen Sequence PEAKIPAKISQMTNLQELHLCHCPAKVEQTAFSFLRDHLRCLHVKFTDVAEIPAWVYLLKNLRELYLIGNLNSENNKMIGLESLRELRHLKILHVKSNLTKVPSNITDVAPHL
Molecular weight 14.1kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >75% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Pro501-Leu613
Protein Accession Q5U308
Spec:Entrez GeneID 305131
Spec:SwissProtID Q5U308
NCBI Reference Q5U308
Aliases /Synonyms Leucine-rich repeat-containing protein 5,Leucine-rich repeat-containing protein 8D,Lrrc5
Reference PX-P4696
Note For research use only
Molecular Constructor
Pro501–Leu613 His

Volume-regulated anion channel subunit LRRC8D (Lrrc8d)

There are no reviews yet.

Be the first to review “Volume-regulated anion channel subunit LRRC8D (Lrrc8d)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products