VAR2CSA(var2csa)

Reference:
Size

10ug, 100ug

Brand

Product type

Host Species

Product nameVAR2CSA(var2csa)
Uniprot IDA0A0K2JPB8
Uniprot linkhttps://www.uniprot.org/uniprot/A0A0K2JPB8
Expression systemProcaryotic expression
SequenceMSYVKNNPYSAEDGKLLKFDGPDAFIESPTYYNNVCCCSTPEKSAKTDGSSSLSSFGTSSSYQSSIITSKKRKECKQIKF SGNKNNMNIKICSTQDNNLLVEFQELLKGFCNISGVNTGGVEVVSEENCEEQYKKLLPCLEKCTILNCNECNKTRCKPLK KVEEKWIWKKYSGNGEGLQKEYANTIGLPPRTQSLYLGNLPKLENVCKDVTDINFDTKEKFLAGCLIAAFHEGKNLKTSH QNKNDDNNSKLCKDLKYSFADYGDLIKGTSIWDNDFTKDLELNLQKAFGKLFRKYIKKNNTAEQHTSYSSLDELRESWWN TNKKYIWLAMKHGAGMNSTTCSCSGDSSDDIPTIDLIPQYLRFLQEWVEHFCKQRQAKVNAVINSCKSCKNTSSKTKLGD TCNSDCEKKCKDECEAYKNFIEKCGTAADGTAGSSWSKRWDQIYKMYSKHIEDAKRNRKAGTKNCGPSSITNAAASTDES KCVQSDIDSFFKHLIDIGLTTPSSYLSIVLDENNCGDDKAPWTTYTTYTTTKNCDKDKKKSKLQQCNTAVVVNVPSPLGN TPHGYKYACECKIPTTEESCDDRKEYMNQWSSGSAQTVRDRSGKDDYELYTYNGVKETKPPKKLNSSKLDGSHHHHHH
Molecular weight71.9kDa
Protein delivered with Tag?C-terminal His Tag
Purity estimated>85% by SDS-PAGE
BufferPBS, pH7.5
Delivery conditionDry Ice
Delivery lead time in business daysEurope: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
BrandProteoGenix
Host speciesEscherichia coli (E.coli)
Fragment TypeSer387-Asp1035
Protein AccessionA0A0K2JPB8
ReferencePX-P4607
NoteFor research use only

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “VAR2CSA(var2csa)”

Your email address will not be published. Required fields are marked *

Related products

Anti His tag mouse monoclonal antibody
Tag Antibody Anti His tag mouse monoclonal antibody PTX17851-100 180€

Contact us

Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.