Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Up-regulated in infective sporozoites(PBANKA_0501200)

Host species:
Escherichia coli (E.coli)
Uniprot ID:
A0A509AFU9
Molecular weight:
18.09kDa

210.00

50ug + 210 loyalty points
Glu79–Ile220
size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Up-regulated in infective sporozoites(PBANKA_0501200)

Product name Up-regulated in infective sporozoites(PBANKA_0501200)
Uniprot ID A0A509AFU9
Uniprot link http://www.uniprot.org/uniprot/A0A509AFU9
Expression system Prokaryotic expression
Raw Antigen Sequence EVREKFRIGKRIKEFDDVNTPQDISLINPVENPYPENSPENSPENSPEKYIEESHKHYTKRFLEQYTEPKPSDHTYSYSPTEEAYNTHYMASDTHEDYGKLFTDEHKDEINDNIVYHDELSDLVGEGNNVYNMENKSFGPYI
Molecular weight 18.09kDa
Purity estimated 80% by SDS-PAGE
Buffer PBS, pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu79-Ile220
Reference PX-P4537
Note For research use only
Molecular Constructor
Glu79–Ile220
Product name Up-regulated in infective sporozoites(PBANKA_0501200)
Uniprot ID A0A509AFU9
Uniprot link http://www.uniprot.org/uniprot/A0A509AFU9
Expression system Prokaryotic expression
Raw Antigen Sequence EVREKFRIGKRIKEFDDVNTPQDISLINPVENPYPENSPENSPENSPEKYIEESHKHYTKRFLEQYTEPKPSDHTYSYSPTEEAYNTHYMASDTHEDYGKLFTDEHKDEINDNIVYHDELSDLVGEGNNVYNMENKSFGPYI
Molecular weight 18.09kDa
Purity estimated 80% by SDS-PAGE
Buffer PBS, pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu79-Ile220
Reference PX-P4537
Note For research use only
Molecular Constructor
Glu79–Ile220

Up-regulated in infective sporozoites(PBANKA_0501200)

There are no reviews yet.

Be the first to review “Up-regulated in infective sporozoites(PBANKA_0501200)”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products