Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Tumor necrosis factor receptor superfamily member 19L(Relt)

Host species:
Mammalian cells
Uniprot ID:
Q8BX43
Molecular weight:
41.56kDa

210.00

50ug + 210 loyalty points
Met1–Ala167 Arg134Gly,Arg136Gly His
size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Tumor necrosis factor receptor superfamily member 19L(Relt)

Product name Tumor necrosis factor receptor superfamily member 19L(Relt)
Uniprot ID Q8BX43
Uniprot link https://www.uniprot.org/uniprot/Q8BX43
Expression system Eukaryotic expression
Raw Antigen Sequence MSLQGLMMKRTLLCWPLSCLFVLLPWPLATPTPITPWLCPPGKEPDPDPGQGTLCRTCPPGTFSASWNSYPCQPHYRCSLQKRLEAQAGTATHDTMCGDCQHGWFGPQGVPHVPCQPCSKAPPSTGGCDESGRGGGRGVEVAAGTSSNGEPRQPGNGTRAGGPEETAMVRSPRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGKHHHHHH
Molecular weight 41.56kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS, pH 7.5.
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Ala167(Arg134Gly,Arg136Gly)
Protein Accession Q8BX43
Spec:Entrez GeneID 320100
Spec:NCBI Gene Aliases Tnfrs; Tnfrsf19l; E430021K24Rik
Spec:SwissProtID Q497Z8
NCBI Reference Q8BX43
Aliases /Synonyms Tnfrsf19l
Reference PX-P4750
Note For research use only
Molecular Constructor
Met1–Ala167 Arg134Gly,Arg136Gly His
Product name Tumor necrosis factor receptor superfamily member 19L(Relt)
Uniprot ID Q8BX43
Uniprot link https://www.uniprot.org/uniprot/Q8BX43
Expression system Eukaryotic expression
Raw Antigen Sequence MSLQGLMMKRTLLCWPLSCLFVLLPWPLATPTPITPWLCPPGKEPDPDPGQGTLCRTCPPGTFSASWNSYPCQPHYRCSLQKRLEAQAGTATHDTMCGDCQHGWFGPQGVPHVPCQPCSKAPPSTGGCDESGRGGGRGVEVAAGTSSNGEPRQPGNGTRAGGPEETAMVRSPRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGKHHHHHH
Molecular weight 41.56kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS, pH 7.5.
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Ala167(Arg134Gly,Arg136Gly)
Protein Accession Q8BX43
Spec:Entrez GeneID 320100
Spec:NCBI Gene Aliases Tnfrs; Tnfrsf19l; E430021K24Rik
Spec:SwissProtID Q497Z8
NCBI Reference Q8BX43
Aliases /Synonyms Tnfrsf19l
Reference PX-P4750
Note For research use only
Molecular Constructor
Met1–Ala167 Arg134Gly,Arg136Gly His

Tumor necrosis factor receptor superfamily member 19L(Relt)

There are no reviews yet.

Be the first to review “Tumor necrosis factor receptor superfamily member 19L(Relt)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products