Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Tubulin beta-3 chain(TUBB3)

Host species:
Escherichia coli (E.coli)
Uniprot ID:
Q13509
Molecular weight:
51.7kDa

210.00

50ug + 210 loyalty points
Met1–Lys450 His
size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Tubulin beta-3 chain(TUBB3)

Product name Tubulin beta-3 chain(TUBB3)
Uniprot ID Q13509
Uniprot link https://www.uniprot.org/uniprot/Q13509
Expression system Prokaryotic expression
Raw Antigen Sequence MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPSGNYVGDSDLQLERISVYYNEASSHKYVPRAILVDLEPGTMDSVRSGAFGHLFRPDNFIFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKECENCDCLQGFQLTHSLGGGTGSGMGTLLISKVREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSIHQLVENTDETYCIDNEALYDICFRTLKLATPTYGDLNHLVSATMSGVTTSLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTARGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVATVFRGRMSMKEVDEQMLAIQSKNSSYFVEWIPNNVKVAVCDIPPRGLKMSSTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEEEGEMYEDDEEESEAQGPK
Molecular weight 51.7kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >80% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Lys450
Protein Accession Q13509
Spec:Entrez GeneID 10381
Spec:NCBI Gene Aliases CDCBM; FEOM3; TUBB4; CDCBM1; CFEOM3; beta-4; CFEOM3A
Spec:SwissProtID Q9BTZ0
NCBI Reference Q13509
Aliases /Synonyms Tubulin beta-4 chain,Tubulin beta-III,TUBB4
Reference PX-P4849
Note For research use only
Molecular Constructor
Met1–Lys450 His
Product name Tubulin beta-3 chain(TUBB3)
Uniprot ID Q13509
Uniprot link https://www.uniprot.org/uniprot/Q13509
Expression system Prokaryotic expression
Raw Antigen Sequence MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPSGNYVGDSDLQLERISVYYNEASSHKYVPRAILVDLEPGTMDSVRSGAFGHLFRPDNFIFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKECENCDCLQGFQLTHSLGGGTGSGMGTLLISKVREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSIHQLVENTDETYCIDNEALYDICFRTLKLATPTYGDLNHLVSATMSGVTTSLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTARGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVATVFRGRMSMKEVDEQMLAIQSKNSSYFVEWIPNNVKVAVCDIPPRGLKMSSTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEEEGEMYEDDEEESEAQGPK
Molecular weight 51.7kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >80% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Lys450
Protein Accession Q13509
Spec:Entrez GeneID 10381
Spec:NCBI Gene Aliases CDCBM; FEOM3; TUBB4; CDCBM1; CFEOM3; beta-4; CFEOM3A
Spec:SwissProtID Q9BTZ0
NCBI Reference Q13509
Aliases /Synonyms Tubulin beta-4 chain,Tubulin beta-III,TUBB4
Reference PX-P4849
Note For research use only
Molecular Constructor
Met1–Lys450 His

Tubulin beta-3 chain(TUBB3)

There are no reviews yet.

Be the first to review “Tubulin beta-3 chain(TUBB3)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products