Trichinella spiralis NBL2 Recombinant Protein

Reference:
Size

10ug, 100ug

Brand

Product type

Host Species

Product nameTrichinella spiralis NBL2 Recombinant Protein
Uniprot IDB0F9T2
Uniprot linkhttp://www.uniprot.org/uniprot/B0F9T2
Origin speciesTrichinella spiralis
Expression systemProcaryotic expression
SequenceMAHNHRHKHKLQILGETTHYGRNDPVMLRNAHEALFSSDLKQESGVFHKLLELEESSTMGILTTMKVVMQDTDCPVSFAL LSYYDVLVNCQGEGRRKHCTMEYTHRNPSKATVSKCFEEVEEPLIIPQRVKMIGGRAVYIDSNADVEEQMQMLGETTHYG RNDPVMLPKAREALFSSDSKEQSGVLHKLVELEESSTMGILTTMKVVIQDTECRVSSAYSSYYDVLHYCHGKGPRKHCTL EYRHRTPSTATVSECFEEVEEPLIVPQRVQRVNGRTIYLDSSDDVEEQVVSQRSQMLGGTTKYTDSNVHIKEEVKQAIFE SDKKKSSGTYLLLDKIVEGFNMGISSRFQVLVKETECGIKEKAFNSYEDVYKNCSGSGDSKVCSVEYKYFDPTKSTVEC
Molecular weight45,20 kDa
Protein delivered with Tag?Yes
Purity estimated>95%
BufferNaH2PO4 100mM, TrisHCl 10mM, Urea 8M
Formliquid
Delivery conditionDry Ice
Delivery lead time in business days10-25
Storage condition4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
BrandProteoGenix
Host speciesEscherichia coli (E.coli)
Fragment TypePartial
Protein AccessionABY60755.1
Spec:SwissProtIDB0F9T2
NCBI ReferenceABY60755.1
Aliases /SynonymsNBL2∆Nter, hypothetical protein
ReferencePX-P1129
NoteFor research use only

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Trichinella spiralis NBL2 Recombinant Protein”

Your email address will not be published. Required fields are marked *

Contact us

Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.