Cart (0 Items)
Your cart is currently empty.
View Productssize | 100ug, 50ug |
---|---|
Brand | ProteoGenix |
Product type | Recombinant Proteins |
Host Species | Escherichia coli (E. coli) |
Applications | Elisa, WB |
Product name | Synthetic SNAP Protein |
---|---|
Uniprot ID | P08515 |
Uniprot link | http://www.uniprot.org/uniprot/P08515 |
Origin species | synthetic construction |
Expression system | Prokaryotic expression |
Sequence | MDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQATAWLNAYFHQPEAIEEFP VPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPAATAAVKTALSGNPVPILIPCHRVVSSSGAVGGYEG GLAVKEWLLAHEGHRLGKPGLGAGIDAIMSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEF PNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKM FEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGG GDHPPKSD |
Molecular weight | 45.44kDa |
Protein delivered with Tag? | Yes |
Purity estimated | 90% |
Buffer | PBS, pH 7.5 |
Form | Frozen |
Delivery condition | Dry Ice |
Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
Brand | ProteoGenix |
Host species | Escherichia coli (E.coli) |
Fragment Type | Unknown |
Protein Accession | AFU51890.1 |
Spec:SwissProtID | P08515 |
NCBI Reference | AFU51890.1 |
Aliases /Synonyms | SNAP, Glutathione S-transferase class-mu 26 kDa isozyme ou GST 26 ou Sj26 antigen ou SjGST ou Glutathione S-transferase domain-containing protein |
Reference | PX-P2096 |
Note | For research use only |
Synaptosome nerve-associated protein also known as SNAP protein is component of SNARE protein complex. SNAP protein is involved in the exocytotic release of neurotransmitters during synaptic transmission. It is believed that SNAP protein controls exocytic and endocytic processes at the presynaptic terminal. Data suggests that SNAP protein is also implicated in postsynaptic receptor trafficking. However, a clear demonstration of SNAP protein localization in postsynaptic neuron is lacking. Even more so, since data suggests that this protein is located in the presynaptic location exclusively.
SNAP protein has also been suggested to play an important role in modulation of voltage-gated calcium channel-mediated (VGCC) signaling, short term plasticity, long term plasticity, dendritic spine morphogenesis, cognitive ability, learning and memory and network excitability. As such, deregulation of SNAP protein has been linked to several disorders such as early onset bipolar disorder, ADHD, increased risk of major depressive disorder and schizophrenia.
SNAP along with syntaxin and synaptobrevin (which are vesicle-associated membranes) have been implicated as central elements of an exocytotic membrane fusion complex in neurons. It is believed that SNAP protein binds directly to both synaptobrevin and syntaxin. Data suggests that SNAP is implicated in the final steps of intracellular membrane fusion.
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.