Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

SYN-005-1B7 Biosimilar – Anti-Pertussis toxin subunit 1 mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: €313.00.Current price is: €259.00.

50ug 17% OFF + 259 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

SYN-005-1B7 Biosimilar - Anti-Pertussis toxin subunit 1 mAb - Research Grade

Product name SYN-005-1B7 Biosimilar - Anti-Pertussis toxin subunit 1 mAb - Research Grade
Uniprot ID P04977
Source hu1B7, SYN-005, SYN-005-1B7
Species Humanized
Expression system XtenCHO
Raw Antigen Sequence MRCTRAIRQTARTGWLTWLAILAVTAPVTSPAWADDPPATVYRYDSRPPEDVFQNGFTAWGNNDNVLDHLTGRSCQVGSSNSAFVSTSSSRRYTEVYLEHRMQEAVEAERAGRGTGHFIGYIYEVRADNNFYGAASSYFEYVDTYGDNAGRILAGALATYQSEYLAHRRIPPENIRRVTRVYHNGITGETTTTEYSNARYVSQQTRANPNPYTSRRSVASIVGTLVRMAPVIGACMARQAESSEAMAAWSERAGEAMVLVYYESIAYSF
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms anti-Pertussis toxin subunit 1,PTX S1,Islet-activating protein S1,IAP S1,NAD-dependent ADP-ribosyltransferase,ptxA,BP3783,hu1B7, SYN-005, SYN-005-1B7
Reference PX-TA1918
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name SYN-005-1B7 Biosimilar - Anti-Pertussis toxin subunit 1 mAb - Research Grade
Uniprot ID P04977
Source hu1B7, SYN-005, SYN-005-1B7
Species Humanized
Expression system XtenCHO
Raw Antigen Sequence MRCTRAIRQTARTGWLTWLAILAVTAPVTSPAWADDPPATVYRYDSRPPEDVFQNGFTAWGNNDNVLDHLTGRSCQVGSSNSAFVSTSSSRRYTEVYLEHRMQEAVEAERAGRGTGHFIGYIYEVRADNNFYGAASSYFEYVDTYGDNAGRILAGALATYQSEYLAHRRIPPENIRRVTRVYHNGITGETTTTEYSNARYVSQQTRANPNPYTSRRSVASIVGTLVRMAPVIGACMARQAESSEAMAAWSERAGEAMVLVYYESIAYSF
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms anti-Pertussis toxin subunit 1,PTX S1,Islet-activating protein S1,IAP S1,NAD-dependent ADP-ribosyltransferase,ptxA,BP3783,hu1B7, SYN-005, SYN-005-1B7
Reference PX-TA1918
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1918-50
Uniprot ID P04977
Source hu1B7, SYN-005, SYN-005-1B7
Species Humanized
Expression system XtenCHO
Raw Antigen Sequence MRCTRAIRQTARTGWLTWLAILAVTAPVTSPAWADDPPATVYRYDSRPPEDVFQNGFTAWGNNDNVLDHLTGRSCQVGSSNSAFVSTSSSRRYTEVYLEHRMQEAVEAERAGRGTGHFIGYIYEVRADNNFYGAASSYFEYVDTYGDNAGRILAGALATYQSEYLAHRRIPPENIRRVTRVYHNGITGETTTTEYSNARYVSQQTRANPNPYTSRRSVASIVGTLVRMAPVIGACMARQAESSEAMAAWSERAGEAMVLVYYESIAYSF
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms anti-Pertussis toxin subunit 1,PTX S1,Islet-activating protein S1,IAP S1,NAD-dependent ADP-ribosyltransferase,ptxA,BP3783,hu1B7, SYN-005, SYN-005-1B7
Reference PX-TA1918
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction to SYN-005-1B7 Biosimilar – Anti-Pertussis Toxin Subunit 1 mAb Introduction:

SYN-005-1B7 Biosimilar is a monoclonal antibody (mAb) that specifically targets the pertussis toxin subunit 1 (PTxS1). This biosimilar is a research grade therapeutic antibody that has been developed as a potential treatment for pertussis, also known as whooping cough. In this article, we will discuss the structure, activity, and potential applications of SYN-005-1B7 Biosimilar.

Structure of SYN-005-1B7 Biosimilar:

SYN-005-1B7 Biosimilar is a recombinant humanized monoclonal antibody that is produced using advanced biotechnology techniques. It is a fully human IgG1 antibody that has been engineered to specifically bind to PTxS1, a key component of the pertussis toxin. The antibody has a molecular weight of approximately 150 kDa and consists of two heavy chains and two light chains. The heavy and light chains are connected by disulfide bonds and form a Y-shaped structure that is characteristic of antibodies.

Activity of SYN-005-1B7 Biosimilar:

The primary function of SYN-005-1B7 Biosimilar is to bind to PTxS1 and inhibit its activity. PTxS1 is a key virulence factor of Bordetella pertussis, the bacterium that causes pertussis. This toxin is responsible for the severe coughing and other symptoms associated with the disease. By binding to PTxS1, SYN-005-1B7 Biosimilar prevents the toxin from entering and damaging the cells of the respiratory tract. This not only reduces the severity of symptoms but also helps in clearing the infection.

In addition to its neutralizing activity, SYN-005-1B7 Biosimilar also has an immune-modulating effect. It is able to stimulate the production of antibodies and T cells that specifically target B. pertussis. This helps in boosting the body’s immune response and provides long-term protection against pertussis.

Application of SYN-005-1B7 Biosimilar:

The primary application of SYN-005-1B7 Biosimilar is in the treatment of pertussis. It is currently being developed as a potential alternative to the existing pertussis vaccines and antibiotics. The biosimilar is designed to be used as a passive immunization therapy, where it is administered to individuals who have been exposed to pertussis or are at high risk of developing the disease. This includes infants, pregnant women, and individuals with compromised immune systems.

Apart from its therapeutic potential, SYN-005-1B7 Biosimilar also has applications in research. The biosimilar can be used as a tool to study the mechanisms of pertussis infection and the role of PTxS1 in the disease. It can also be used to develop more effective vaccines and treatments for pertussis.

Conclusion:

SYN-005-1B7 Biosimilar is a promising research grade therapeutic antibody that specifically targets PTxS1, a key virulence factor of B. pertussis. Its unique structure and activity make it a potential alternative to existing pertussis vaccines and antibiotics. The biosimilar has the potential to provide both immediate and long-term protection against pertussis and has applications in both therapeutic and research settings. Further studies and clinical trials are needed to fully evaluate the efficacy and safety of SYN-005-1B7 Biosimilar, but it holds great promise in the fight against pertussis.

SDS-PAGE for SYN-005-1B7 Biosimilar - Anti-ptxAPTXS1 mAb - Research Grade

SDS-PAGE for SYN-005-1B7 Biosimilar - Anti-ptxAPTXS1 mAb - Research Grade

SYN-005-1B7 Biosimilar - Anti-ptxAPTXS1 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

SYN-005-1B7 Biosimilar - Anti-Pertussis toxin subunit 1 mAb - Research Grade

There are no reviews yet.

Be the first to review “SYN-005-1B7 Biosimilar – Anti-Pertussis toxin subunit 1 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products