Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

SuHV-1 gC/Envelope glycoprotein C, N-His-KSI

Host species:
Escherichia coli (E.coli)
Origin species:
Suid herpesvirus 1 (SuHV-1) (Pseudorabies virus)
Uniprot ID:
A0A2H4R851

Original price was: €280.00.Current price is: €228.00.

50ug 19% OFF + 228 loyalty points
His-KSI Ser206–Ser294
Size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
SuHV-1 gC/Envelope glycoprotein C, N-His-KSI

SuHV-1 gC/Envelope glycoprotein C, N-His-KSI

Product name ARO-P18509-100
Uniprot ID A0A2H4R851
Origin species Suid herpesvirus 1 (SuHV-1) (Pseudorabies virus)
Expression system Prokaryotic expression
Raw Antigen Sequence SVRVAAADAETEGVYTWRVLSANGTEVRSANVSLVLYHQPEFGLSAPPVLFGEPFRAVCVVRDYYPRRSVRLRWFADEHPVDAAFVTNS
Protein delivered with Tag? N-Terminal His-KSI Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser206-Ser294
Aliases /Synonyms Glycoprotein C
Reference ARO-P18509
Note For research use only.
Molecular Constructor
His-KSI Ser206–Ser294
Product name ARO-P18509-1MG
Uniprot ID A0A2H4R851
Origin species Suid herpesvirus 1 (SuHV-1) (Pseudorabies virus)
Expression system Prokaryotic expression
Raw Antigen Sequence SVRVAAADAETEGVYTWRVLSANGTEVRSANVSLVLYHQPEFGLSAPPVLFGEPFRAVCVVRDYYPRRSVRLRWFADEHPVDAAFVTNS
Protein delivered with Tag? N-Terminal His-KSI Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser206-Ser294
Aliases /Synonyms Glycoprotein C
Reference ARO-P18509
Note For research use only.
Molecular Constructor
His-KSI Ser206–Ser294
Product name ARO-P18509-50
Uniprot ID A0A2H4R851
Origin species Suid herpesvirus 1 (SuHV-1) (Pseudorabies virus)
Expression system Prokaryotic expression
Raw Antigen Sequence SVRVAAADAETEGVYTWRVLSANGTEVRSANVSLVLYHQPEFGLSAPPVLFGEPFRAVCVVRDYYPRRSVRLRWFADEHPVDAAFVTNS
Protein delivered with Tag? N-Terminal His-KSI Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser206-Ser294
Aliases /Synonyms Glycoprotein C
Reference ARO-P18509
Note For research use only.
Molecular Constructor
His-KSI Ser206–Ser294

There are no reviews yet.

Be the first to review “SuHV-1 gC/Envelope glycoprotein C, N-His-KSI”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products