Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

STRO-001 Biosimilar – Anti-HLA-DR antigens-associated invariant chain mAb – Research Grade

  • PX-TA1913-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG1

Original price was: €339.00.Current price is: €259.00.

50ug 24% OFF + 259 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

STRO-001 Biosimilar - Anti-HLA-DR antigens-associated invariant chain mAb - Research Grade

Product name STRO-001 Biosimilar - Anti-HLA-DR antigens-associated invariant chain mAb - Research Grade
Uniprot ID P04233
Source SP7219
Species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MHRRRSRSCREDQKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGALYTGFSILVTLLLAGQATTAYFLYQQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPKVLTKCQEEVSHIPAVHPGSFRPKCDENGNYLPLQCYGSIGYCWCVFPNGTEVPNTRSRGHHNCSESLELEDPSSGLGVTKQDLGPVPM
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms anti-HLA-DR antigens-associated invariant chain,HLA class II histocompatibility antigen gamma chain,CD74,CLIP,Ia antigen-associated invariant chain,DHLAG,Ii,SP7219
Reference PX-TA1913
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1
Clonality Monoclonal Antibody
Product name STRO-001 Biosimilar - Anti-HLA-DR antigens-associated invariant chain mAb - Research Grade
Uniprot ID P04233
Source SP7219
Species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MHRRRSRSCREDQKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGALYTGFSILVTLLLAGQATTAYFLYQQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPKVLTKCQEEVSHIPAVHPGSFRPKCDENGNYLPLQCYGSIGYCWCVFPNGTEVPNTRSRGHHNCSESLELEDPSSGLGVTKQDLGPVPM
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms anti-HLA-DR antigens-associated invariant chain,HLA class II histocompatibility antigen gamma chain,CD74,CLIP,Ia antigen-associated invariant chain,DHLAG,Ii,SP7219
Reference PX-TA1913
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1
Clonality Monoclonal Antibody
Product name PX-TA1913-50
Uniprot ID P04233
Source SP7219
Species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MHRRRSRSCREDQKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGALYTGFSILVTLLLAGQATTAYFLYQQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPKVLTKCQEEVSHIPAVHPGSFRPKCDENGNYLPLQCYGSIGYCWCVFPNGTEVPNTRSRGHHNCSESLELEDPSSGLGVTKQDLGPVPM
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms anti-HLA-DR antigens-associated invariant chain,HLA class II histocompatibility antigen gamma chain,CD74,CLIP,Ia antigen-associated invariant chain,DHLAG,Ii,SP7219
Reference PX-TA1913
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1
Clonality Monoclonal Antibody

Introduction

STRO-001 Biosimilar is a novel monoclonal antibody (mAb) that specifically targets the human leukocyte antigen-DR (HLA-DR) antigens-associated invariant chain (Ii). This biosimilar is a promising therapeutic agent for the treatment of various types of cancer. In this article, we will discuss the structure, activity, and potential applications of STRO-001 Biosimilar in the field of oncology.

Structure

STRO-001 Biosimilar is a recombinant humanized mAb that belongs to the IgG1 subclass. It has a molecular weight of approximately 150 kDa and is composed of two heavy chains and two light chains. The heavy chains consist of three constant domains (CH1, CH2, and CH3) and one variable domain (VH), while the light chains contain one constant domain (CL) and one variable domain (VL). The variable domains of the heavy and light chains are responsible for the antigen-binding specificity of STRO-001 Biosimilar.

Activity

STRO-001 Biosimilar specifically targets the HLA-DR antigens-associated Ii, which is a chaperone protein involved in the presentation of antigens to T cells. The overexpression of Ii has been observed in various types of cancer, including B-cell lymphomas, multiple myeloma, and solid tumors. By targeting Ii, STRO-001 Biosimilar inhibits the presentation of tumor antigens to T cells, thereby preventing the activation of an immune response against the cancer cells.

In addition, STRO-001 Biosimilar also induces antibody-dependent cellular cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC). These mechanisms of action further enhance the anti-tumor activity of STRO-001 Biosimilar by promoting the destruction of cancer cells.

Application

STRO-001 Biosimilar has shown promising results in preclinical studies, demonstrating its potential as a therapeutic agent for the treatment of various types of cancer. It has been shown to effectively inhibit tumor growth in animal models of B-cell lymphoma, multiple myeloma, and solid tumors. Moreover, STRO-001 Biosimilar has also shown synergistic effects when combined with other anti- cancer therapies, such as chemotherapy and targeted therapy.

Currently, STRO-001 Biosimilar is being evaluated in phase 1 clinical trials for the treatment of relapsed or refractory B-cell non-Hodgkin lymphoma and multiple myeloma. These trials aim to assess the safety, tolerability, and efficacy of STRO-001 Biosimilar in human subjects. If successful, STRO-001 Biosimilar could potentially become a new treatment option for patients with these types of cancer.

Conclusion

In summary, STRO-001 Biosimilar is a promising therapeutic agent that specifically targets the HLA-DR antigens-associated Ii, a protein overexpressed in various types of cancer. Its unique mechanism of action, along with its potential for synergistic effects, make it a promising candidate for the treatment of B-cell lymphoma, multiple myeloma, and solid tumors. With ongoing clinical trials, STRO-001 Biosimilar could potentially become a valuable addition to the current arsenal of anti- cancer therapies.

STRO-001 Biosimilar - Anti-CD74 mAb - Research Grade in ELISA Assay

STRO-001 Biosimilar - Anti-CD74 mAb - Research Grade in ELISA Assay

STRO-001 Biosimilar - Anti-CD74 mAb - Research Grade can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

SDS-PAGE for STRO-001 Biosimilar - Anti-CD74 mAb - Research Grade

SDS-PAGE for STRO-001 Biosimilar - Anti-CD74 mAb - Research Grade

STRO-001 Biosimilar - Anti-CD74 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

STRO-001 Biosimilar - Anti-HLA-DR antigens-associated invariant chain mAb - Research Grade

There are no reviews yet.

Be the first to review “STRO-001 Biosimilar – Anti-HLA-DR antigens-associated invariant chain mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products