Name: Streptococcus 6His-Protein G
SKU: PX-P2102-10mg
Price: 567.00 EUR
Availability: InStock

Product name	Streptococcus 6His-Protein G
Origin species	Streptococcus
Expression system	Procaryotic expression
Sequence	MGKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEKPEVIDASELTPAVTTYKLVINGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEKPEVIDASELTPAVTTYKLVINGKTLKGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVTEHHHHHH
Molecular weight	20.96 KDa
Protein delivered with Tag?	Yes
Purity estimated	90%
Buffer	PBS,pH7.5
Form	Frozen
Delivery condition	Dry Ice
Delivery lead time in business days	10-25
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Partial
Spec:SwissProtID	P19909
NCBI Reference	CAA37410.1
Aliases /Synonyms	6His-Protein G
Reference	PX-P2102
Note	For research use only

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Streptococcus 6His-Protein G”

€567.00In stock

Size

Please select the country of delivery so that we can send you the quotation including shipping costs.

Thank you for your request! You will receive your quotation per e-mail in a few seconds.

If you did not receive your quotation, please check your spam folder.

Contact us

Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.