Name: Staphylococcus GlmCat Recombinant Protein
SKU: PX-P2072-10
Availability: InStock

Product name	Staphylococcus GlmCat Recombinant Protein
Origin species	Staphylococcus
Expression system	Prokaryotic expression
Sequence	MAHNHRHKHKLVNAKDLTAPTAVKPTTSAAKDYNYTYVIKNGNGYYYVTPNSDTAKYSLKAFNEQPFAVVKEQVINGQTWYYGKLSNGKLAWIKSTDLAKELIKYNQTGMTLNQVAQIQAGLQYKPQVQRVPGKWTGANFNDVKHAMDTKRLAQDPALKYQFLRLDQPQNISIDKINQFLKGKGVLENQGAAFNKAAQMYGINEVYLISHALLETGNGTSQLAKGADVVNNKVVTNSNTKYHNVFGIAAYDNDPL
Molecular weight	38.20 kDa
Protein delivered with Tag?	Yes
Purity estimated	90%
Buffer	PBS, pH 7.5
Form	Frozen
Delivery condition	Dry Ice
Delivery lead time in business days	10-25
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Applications	ELISA,WB
Fragment Type	Partial
Protein Accession	KEK36855.1
Spec:Entrez GeneID	5330556
Spec:SwissProtID	A6QFR2
NCBI Reference	KEK36855.1
Aliases /Synonyms	GlmCat, Bifunctional autolysin
Reference	PX-P2072
Note	For research use only

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Staphylococcus GlmCat Recombinant Protein”

Size

Clear

Please select the country of delivery so that we can send you the quotation including shipping costs.

Thank you for your request! You will receive your quotation per e-mail in a few seconds.

If you did not receive your quotation, please check your spam folder.

Contact us

Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.