Name: Staphylococcus AmiCat Recombinant Protein
SKU: PX-P2062-10
Availability: InStock

Product name	Staphylococcus AmiCat Recombinant Protein
Origin species	Staphylococcus
Expression system	Prokaryotic expression
Sequence	MAHNHRHKHKLASAQPRSVAATPKTSLPKYKPQVNSSINDYIRKNNLKAPKIEEDYTSYFPKYAYRNGVGRPEGIVVHDTANDRSTINGEISYMKNNYQNAFVHAFVDGDRIIETAPTDYLSWGVGAVGNPRFINVEIVHTHDYASFARSMNNYADYAATQLQYYGLKPDSAEYDGNGTVWTHYAVSKYLGGTDHADPHGYLRSHNYSYDQLYDLINEKYLIKMGKVAPWGTQSTTTPTTPSKPTTPSKP
Molecular weight	28.11 kDa
Protein delivered with Tag?	Yes
Purity estimated	90%
Buffer	PBS, pH 7.5
Form	Frozen
Delivery condition	Dry Ice
Delivery lead time in business days	10-25
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Applications	ELISA,WB
Fragment Type	Partial
Protein Accession	KFA44079.1
Spec:Entrez GeneID	1113, 12330922
Spec:NCBI Gene Aliases	CGA
Spec:SwissProtID	D9RNW1
NCBI Reference	KFA44079.1
Aliases /Synonyms	AmiCat, chromogranin A (parathyroid secretory protein 1)
Reference	PX-P2062
Note	For research use only

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Staphylococcus AmiCat Recombinant Protein”

Size

Clear

OK

Please select the country of delivery so that we can send you the quotation including shipping costs.

Thank you for your request! You will receive your quotation per e-mail in a few seconds.

If you did not receive your quotation, please check your spam folder.

Staphylococcus AmiCat Recombinant Protein