Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Sodium-glucose cotransporter 2(SLC5A2）

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
P31639

€210.00

50ug + 210 loyalty points
Ser335–Leu423 His
size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Sodium-glucose cotransporter 2(SLC5A2）

Sodium-glucose cotransporter 2(SLC5A2）

Product name Sodium-glucose cotransporter 2(SLC5A2）
Uniprot ID P31639
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Sequence MKHLWFFLLLVAAPRWVLSSRILYPDEVACVVPEVCRRVCGTEVGCSNIAYPRLVVKLMPNGLRGLMLAVMLAALMSSLASIFNSSSTLFTMDIYTRLRPRAGDRELLGSHHHHHH
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Ser335-Leu423
Aliases /Synonyms Na(+)/glucose cotransporter 2,Low affinity sodium-glucose cotransporter,Solute carrier family 5 member 2,SGLT2
Reference PX-P4694
Note For research use only
Molecular Constructor
Ser335–Leu423 His
Product name Sodium-glucose cotransporter 2(SLC5A2）
Uniprot ID P31639
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Sequence MKHLWFFLLLVAAPRWVLSSRILYPDEVACVVPEVCRRVCGTEVGCSNIAYPRLVVKLMPNGLRGLMLAVMLAALMSSLASIFNSSSTLFTMDIYTRLRPRAGDRELLGSHHHHHH
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Ser335-Leu423
Aliases /Synonyms Na(+)/glucose cotransporter 2,Low affinity sodium-glucose cotransporter,Solute carrier family 5 member 2,SGLT2
Reference PX-P4694
Note For research use only
Molecular Constructor
Ser335–Leu423 His

There are no reviews yet.

Be the first to review “Sodium-glucose cotransporter 2(SLC5A2）”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products