Name: Sodium-glucose cotransporter 2(SLC5A2）
SKU: PX-P4694-10
Availability: InStock

Product name	Sodium-glucose cotransporter 2(SLC5A2）
Uniprot ID	P31639
Origin species	Homo sapiens (Human)
Expression system	Eukaryotic expression
Sequence	MKHLWFFLLLVAAPRWVLSSRILYPDEVACVVPEVCRRVCGTEVGCSNIAYPRLVVKLMPNGLRGLMLAVMLAALMSSLASIFNSSSTLFTMDIYTRLRPRAGDRELLGSHHHHHH
Protein delivered with Tag?	C-terminal His Tag
Purity estimated	>90%by SDS-PAGE
Buffer	PBS, pH7.5
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Mammalian cells
Applications	ELISA,WB
Fragment Type	Ser335-Leu423
Aliases /Synonyms	Na(+)/glucose cotransporter 2,Low affinity sodium-glucose cotransporter,Solute carrier family 5 member 2,SGLT2
Reference	PX-P4694
Note	For research use only

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Sodium-glucose cotransporter 2(SLC5A2）”

Size

Clear

Please select the country of delivery so that we can send you the quotation including shipping costs.

Thank you for your request! You will receive your quotation per e-mail in a few seconds.

If you did not receive your quotation, please check your spam folder.

Contact us

PTX17851 180€

View product

Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.