Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Sirexatamab Biosimilar – Anti-Dickkopf-1 mAb – Research Grade

  • PX-TA1779-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG4, Kappa

Original price was: €175.00.Current price is: €140.00.

50ug 20% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Sirexatamab Biosimilar - Anti-Dickkopf-1 mAb - Research Grade

Product name Sirexatamab Biosimilar - Anti-Dickkopf-1 mAb - Research Grade
Uniprot ID O94907
Source CAS: 2414962-49-3
Species Humanized
Expression system XtenCHO
Raw Antigen Sequence MMALGAAGATRVFVAMVAAALGGHPLLGVSATLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQRH
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Sirexatamab,DKN-01, LY-2812176,Dickkopf-1,anti-Dickkopf-1
Reference PX-TA1779
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4-kappa
Clonality Monoclonal Antibody
Product name Sirexatamab Biosimilar - Anti-Dickkopf-1 mAb - Research Grade
Uniprot ID O94907
Source CAS: 2414962-49-3
Species Humanized
Expression system XtenCHO
Raw Antigen Sequence MMALGAAGATRVFVAMVAAALGGHPLLGVSATLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQRH
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Sirexatamab,DKN-01, LY-2812176,Dickkopf-1,anti-Dickkopf-1
Reference PX-TA1779
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4-kappa
Clonality Monoclonal Antibody
Product name PX-TA1779-50
Uniprot ID O94907
Source CAS: 2414962-49-3
Species Humanized
Expression system XtenCHO
Raw Antigen Sequence MMALGAAGATRVFVAMVAAALGGHPLLGVSATLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQRH
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Sirexatamab,DKN-01, LY-2812176,Dickkopf-1,anti-Dickkopf-1
Reference PX-TA1779
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4, Kappa
Clonality Monoclonal Antibody

The Structure of Sirexatamab Biosimilar – Anti-Dickkopf-1 mAb

Sirexatamab Biosimilar, also known as Anti-Dickkopf-1 mAb, is a monoclonal antibody that has been developed as a potential therapeutic agent for various types of cancers. This biosimilar is a highly specific antibody that targets the Dickkopf-1 (DKK1) protein, which is known to play a crucial role in the development and progression of cancer. The structure of Sirexatamab Biosimilar is composed of two heavy chains and two light chains, making it a typical IgG1-type monoclonal antibody.

The Activity of Sirexatamab Biosimilar

Sirexatamab Biosimilar works by binding to the DKK1 protein and inhibiting its activity. DKK1 is a secreted protein that is overexpressed in many types of cancer, including breast, lung, and prostate cancer. This protein is known to promote tumor growth and metastasis by activating the Wnt signaling pathway. By binding to DKK1, Sirexatamab Biosimilar blocks its interaction with the Wnt receptor, thereby inhibiting the Wnt signaling pathway and preventing cancer cells from proliferating and spreading.

In addition to its anti-tumor activity, Sirexatamab Biosimilar has also been shown to have immunomodulatory effects. It can enhance the activity of natural killer (NK) cells, a type of immune cell that plays a critical role in fighting cancer. By activating NK cells, Sirexatamab Biosimilar can help to eliminate cancer cells and enhance the overall anti-tumor immune response.

The Application of Sirexatamab Biosimilar

Sirexatamab Biosimilar is currently being investigated as a potential treatment for various types of cancer, including solid tumors and hematologic malignancies. It is being studied in both preclinical and clinical trials, and early results have shown promising anti-tumor activity and a good safety profile.

One of the potential applications of Sirexatamab Biosimilar is in combination with other cancer therapies. It has been shown to enhance the activity of chemotherapy and targeted therapies, making it a promising candidate for combination treatments. Furthermore, its immunomodulatory effects make it a potential partner for immunotherapies, such as checkpoint inhibitors, which can help to boost the anti-tumor immune response.

Another potential application of Sirexatamab Biosimilar is in the treatment of bone metastases. DKK1 is known to play a role in bone metabolism, and its overexpression in cancer cells can lead to bone destruction and the formation of bone metastases. By inhibiting DKK1, Sirexatamab Biosimilar may help to prevent or slow down the progression of bone metastases and improve the quality of life for cancer patients.

Conclusion

In summary, Sirexatamab Biosimilar – Anti-Dickkopf-1 mAb – Research Grade is a promising therapeutic agent that specifically targets the DKK1 protein, a key player in cancer development and progression. Its unique structure and mechanism of action make it a potential treatment option for various types of cancer, either as a monotherapy or in combination with other therapies. Further research and clinical trials are needed to fully understand the potential of Sirexatamab Biosimilar and its role in the treatment of cancer.

SEC-HPLC of Sirexatamab Biosimilar - Anti-Dickkopf-1 mAb - Research Grade

SEC-HPLC of Sirexatamab Biosimilar - Anti-Dickkopf-1 mAb - Research Grade

Sirexatamab Biosimilar - Anti-Dickkopf-1 mAb - Research Gradewas analyzed by size exclusion chromatography with UV detection.

SDS-PAGE for Sirexatamab Biosimilar - Anti-Dickkopf-1 mAb - Research Grade

SDS-PAGE for Sirexatamab Biosimilar - Anti-Dickkopf-1 mAb - Research Grade

Sirexatamab Biosimilar - Anti-Dickkopf-1 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Sirexatamab Biosimilar - Anti-Dickkopf-1 mAb - Research Grade

There are no reviews yet.

Be the first to review “Sirexatamab Biosimilar – Anti-Dickkopf-1 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products