Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Sheep SOCS2R96C (Mutant) Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
Sheep
Uniprot ID:
W5Q2U4
Molecular weight:
39,47 kDa

€210.00

50ug + 210 loyalty points
Full-length Yes
size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Sheep SOCS2R96C (Mutant) Recombinant Protein

Sheep SOCS2R96C (Mutant) Recombinant Protein

Product name Sheep SOCS2R96C (Mutant) Recombinant Protein
Uniprot ID W5Q2U4
Uniprot link http://www.uniprot.org/uniprot/W5Q2U4
Origin species Sheep
Expression system Prokaryotic expression
Sequence MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLL LFKNGEVAATKVGALSKGQLKEFLDANLAGSGSGHMHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAM AMTLRCLESSGNGAEGAQSQWGTAGSAEEPSPEAARLAKALRELSHTGWYWGNMTVNEAKEKLKEAPEGTFLIRDSSHSD YLLTISVKTSAGPTNLCIEYQDGKFRLDSIICVKSKLKQFDSVVHLIDYYVQMCKDKRTGPEAPRNGTVHLYLTKPLYTS APPLQHLCRLTINKCTSTIWGLPLPTRLKDYLEEYKFQV
Molecular weight 39,47 kDa
Protein delivered with Tag? Yes
Purity estimated ≥95%
Buffer Tris 50mM NaCl 150mM, pH9 (after refolding)
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Full-length
Protein Accession XP_004006307.1
Spec:Entrez GeneID 101115017
Spec:SwissProtID W5Q2U4
NCBI Reference XP_004006307.1
Aliases /Synonyms SOCS2R96C (Mutant), suppressor of cytokine signaling 2
Reference PX-P1155
Note For research use only
Molecular Constructor
Full-length Yes
Product name Sheep SOCS2R96C (Mutant) Recombinant Protein
Uniprot ID W5Q2U4
Uniprot link http://www.uniprot.org/uniprot/W5Q2U4
Origin species Sheep
Expression system Prokaryotic expression
Sequence MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLL LFKNGEVAATKVGALSKGQLKEFLDANLAGSGSGHMHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAM AMTLRCLESSGNGAEGAQSQWGTAGSAEEPSPEAARLAKALRELSHTGWYWGNMTVNEAKEKLKEAPEGTFLIRDSSHSD YLLTISVKTSAGPTNLCIEYQDGKFRLDSIICVKSKLKQFDSVVHLIDYYVQMCKDKRTGPEAPRNGTVHLYLTKPLYTS APPLQHLCRLTINKCTSTIWGLPLPTRLKDYLEEYKFQV
Molecular weight 39,47 kDa
Protein delivered with Tag? Yes
Purity estimated ≥95%
Buffer Tris 50mM NaCl 150mM, pH9 (after refolding)
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Full-length
Protein Accession XP_004006307.1
Spec:Entrez GeneID 101115017
Spec:SwissProtID W5Q2U4
NCBI Reference XP_004006307.1
Aliases /Synonyms SOCS2R96C (Mutant), suppressor of cytokine signaling 2
Reference PX-P1155
Note For research use only
Molecular Constructor
Full-length Yes

There are no reviews yet.

Be the first to review “Sheep SOCS2R96C (Mutant) Recombinant Protein”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products