Sheep SOCS2R96C (Mutant) Recombinant Protein

Reference:
Size

10ug, 100ug

Brand

Product type

Host Species

Product nameSheep SOCS2R96C (Mutant) Recombinant Protein
Uniprot IDW5Q2U4
Uniprot linkhttp://www.uniprot.org/uniprot/W5Q2U4
Origin speciesSheep
Expression systemProcaryotic expression
SequenceMSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLL LFKNGEVAATKVGALSKGQLKEFLDANLAGSGSGHMHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAM AMTLRCLESSGNGAEGAQSQWGTAGSAEEPSPEAARLAKALRELSHTGWYWGNMTVNEAKEKLKEAPEGTFLIRDSSHSD YLLTISVKTSAGPTNLCIEYQDGKFRLDSIICVKSKLKQFDSVVHLIDYYVQMCKDKRTGPEAPRNGTVHLYLTKPLYTS APPLQHLCRLTINKCTSTIWGLPLPTRLKDYLEEYKFQV
Molecular weight39,47 kDa
Protein delivered with Tag?Yes
Purity estimated≥95%
BufferTris 50mM NaCl 150mM, pH9 (after refolding)
Formliquid
Delivery conditionDry Ice
Delivery lead time in business days10-25
Storage condition4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
BrandProteoGenix
Host speciesEscherichia coli (E.coli)
Fragment TypeFull-length
Protein AccessionXP_004006307.1
Spec:Entrez GeneID101115017
Spec:SwissProtIDW5Q2U4
NCBI ReferenceXP_004006307.1
Aliases /SynonymsSOCS2R96C (Mutant), suppressor of cytokine signaling 2
ReferencePX-P1155
NoteFor research use only

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Sheep SOCS2R96C (Mutant) Recombinant Protein”

Your email address will not be published. Required fields are marked *

Contact us

Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.