Cart (0 Items)
Your cart is currently empty.
View Products-
-
-
Sheep SOCS2R96C (Mutant) Recombinant Protein
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Escherichia coli (E. coli) |
| Applications | Elisa, WB |
| Product name | Sheep SOCS2R96C (Mutant) Recombinant Protein |
|---|---|
| Uniprot ID | W5Q2U4 |
| Uniprot link | http://www.uniprot.org/uniprot/W5Q2U4 |
| Origin species | Sheep |
| Expression system | Prokaryotic expression |
| Sequence | MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLL LFKNGEVAATKVGALSKGQLKEFLDANLAGSGSGHMHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAM AMTLRCLESSGNGAEGAQSQWGTAGSAEEPSPEAARLAKALRELSHTGWYWGNMTVNEAKEKLKEAPEGTFLIRDSSHSD YLLTISVKTSAGPTNLCIEYQDGKFRLDSIICVKSKLKQFDSVVHLIDYYVQMCKDKRTGPEAPRNGTVHLYLTKPLYTS APPLQHLCRLTINKCTSTIWGLPLPTRLKDYLEEYKFQV |
| Molecular weight | 39,47 kDa |
| Protein delivered with Tag? | Yes |
| Purity estimated | ≥95% |
| Buffer | Tris 50mM NaCl 150mM, pH9 (after refolding) |
| Form | liquid |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 10-25 |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Full-length |
| Protein Accession | XP_004006307.1 |
| Spec:Entrez GeneID | 101115017 |
| Spec:SwissProtID | W5Q2U4 |
| NCBI Reference | XP_004006307.1 |
| Aliases /Synonyms | SOCS2R96C (Mutant), suppressor of cytokine signaling 2 |
| Reference | PX-P1155 |
| Note | For research use only |
Contact us
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.