Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: Abnova

SGCG (Human) Recombinant Protein (P01)

Note:
For research use only.

256.00

10 ug + 256 loyalty points
GST 1-291
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
SGCG (Human) Recombinant Protein (P01)

SGCG (Human) Recombinant Protein (P01)

Product name SGCG (Human) Recombinant Protein (P01)
Uniprot ID NP_000222.1
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence MVREQYTTATEGICIERPENQYVYKIGIYGWRKRCLYL FVLLLLIILVVNLALTIWILKVMWFSPAGMGHLCVTKDG LRLEGESEFLFPLYAKEIHSRVDSSLLLQSTQNVTVNA RNSEGEVTGRLKVGPKMVEVQNQQFQINSNDGKPLF TVDEKEVVVGTDKLRVTGPEGALFEHSVETPLVRADP FQDLRLESPTRSLSMDAPRGVHIQAHAGKIEALSQMDI LFHSSDGMLVLDAETVCLPKLVQGTWGPSGSSQSLYE ICVCPDGKLYLSVAGVSTTCQEHSHICL
Molecular weight 58.8 kDa
Protein delivered with Tag? N-Terminal GST Tag
Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Store at -80°C. Aliquot to avoid repeated freezing and thawing
Brand Abnova
Fragment Type 1-291
Aliases /Synonyms A4, DAGA4, DMDA, DMDA1, LGMD2C, MAM, MGC130048, SCARMD2, SCG
Reference H00006445-P01
Note For research use only.
Molecular Constructor
GST 1-291

This gene encodes gamma-sarcoglycan, one of several sarcolemmal transmembrane glycoproteins that interact with dystrophin. The dystrophin-glycoprotein complex (DGC) spans the sarcolemma and is comprised of dystrophin, syntrophin, alpha- and beta-dystroglycans and sarcoglycans. The DGC provides a structural link between the subsarcolemmal cytoskeleton and the extracellular matrix of muscle cells. Defects in the encoded protein can lead to early onset autosomal recessive muscular dystrophy, in particular limb-girdle muscular dystrophy, type 2C (LGMD2C).

There are no reviews yet.

Be the first to review “SGCG (Human) Recombinant Protein (P01)”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products