Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Serum paraoxonase-lactonase 3(PON3)

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
Q15166
Molecular weight:
37.51 kDa

€329.00

100ug + 329 loyalty points
His Leu22–Leu354
size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Serum paraoxonase-lactonase 3(PON3)

Serum paraoxonase-lactonase 3(PON3)

Product name Serum paraoxonase-lactonase 3(PON3)
Uniprot ID Q15166
Uniprot link https://www.uniprot.org/uniprot/Q15166
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Sequence LAFRERVNASREVEPVEPENCHLIEELENGSEDIDILPSGLAFISSGLKYPGMPNFAPDEPGKIFLMDLNEQ NPRAQALEISGGFDKELFNPHGISIFIDKDNTVYLYVVNHPHMKSTVEIFKFEEQQRSLVYLKTIKHELLKS VNDIVVLGPEQFYATRDHYFTNSLLSFFEMILDLRWTYVLFYSPREVKVVAKGFCSANGITVSADQKYVYVA DVAAKNIHIMEKHDNWDLTQLKVIQLGTLVDNLTVDPATGDILAGCHPNPMKLLNYNPEDPPGSEVLRIQNV LSEKPRVSTVYANNGSVLQGTSVASVYHGKILIGTVFHKTLYCEL*
Molecular weight 37.51 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH 7.5, 0.02% SKL
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu22-Leu354
Protein Accession Q15166
Spec:Entrez GeneID 5446
Spec:SwissProtID Q9BZH9
NCBI Reference Q15166
Aliases /Synonyms /
Reference PX-P4784
Note For research use only
Molecular Constructor
His Leu22–Leu354
Product name Serum paraoxonase-lactonase 3(PON3)
Uniprot ID Q15166
Uniprot link https://www.uniprot.org/uniprot/Q15166
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Sequence LAFRERVNASREVEPVEPENCHLIEELENGSEDIDILPSGLAFISSGLKYPGMPNFAPDEPGKIFLMDLNEQ NPRAQALEISGGFDKELFNPHGISIFIDKDNTVYLYVVNHPHMKSTVEIFKFEEQQRSLVYLKTIKHELLKS VNDIVVLGPEQFYATRDHYFTNSLLSFFEMILDLRWTYVLFYSPREVKVVAKGFCSANGITVSADQKYVYVA DVAAKNIHIMEKHDNWDLTQLKVIQLGTLVDNLTVDPATGDILAGCHPNPMKLLNYNPEDPPGSEVLRIQNV LSEKPRVSTVYANNGSVLQGTSVASVYHGKILIGTVFHKTLYCEL*
Molecular weight 37.51 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH 7.5, 0.02% SKL
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu22-Leu354
Protein Accession Q15166
Spec:Entrez GeneID 5446
Spec:SwissProtID Q9BZH9
NCBI Reference Q15166
Aliases /Synonyms /
Reference PX-P4784
Note For research use only
Molecular Constructor
His Leu22–Leu354

There are no reviews yet.

Be the first to review “Serum paraoxonase-lactonase 3(PON3)”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products