Schistosoma GST Recombinant Protein

Reference:
Size

10ug, 100ug

Brand

Product type

Host Species

Product nameSchistosoma GST Recombinant Protein
Origin speciesSchistosoma
Expression systemProcaryotic expression
SequenceMSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHN MLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALD VVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSPEFPGRLER PHRD
Molecular weight28,38 kDa
Protein delivered with Tag?No
Purity estimated>95%
BufferPBS, pH 7.5
FormFrozen
Delivery conditionDry Ice
Delivery lead time in business days5-7
Storage condition4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
BrandProteoGenix
Host speciesEscherichia coli (E.coli)
Fragment TypeFull-length
Protein AccessionAAB37346.1
NCBI ReferenceAAB37346.1
Aliases /SynonymsGST, glutathione S-transferase
ReferencePX-P1103
Publications1: Smith DB, Johnson KS. Single-step purification of polypeptides expressed in Escherichia coli as fusions with glutathione S-transferase. Gene. 1988 Jul 15;67(1):31-40. PubMed PMID: 3047011. 2: Cordingley MG, Callahan PL, Sardana VV, Garsky VM, Colonno RJ. Substrate requirements of human rhinovirus 3C protease for peptide cleavage in vitro. J Biol Chem. 1990 Jun 5;265(16):9062-5. PubMed PMID: 2160953.
NoteFor research use only

General information on Schistosoma GST Recombinant Protein:

Glutathione S-transferase (GST) is a 28 kDa enzyme initially found in Schistosoma japonicum, but presently isolated from a recombinant E. coli source. It catalyzes the extension of the glutathione thiol group to a suitable electrophilic species. Enzymatic activities are based on the conjugation of reduced glutathione in the presence of a second substrate.

Publication

1: Smith DB, Johnson KS. Single-step purification of polypeptides expressed in Escherichia coli as fusions with glutathione S-transferase. Gene. 1988 Jul 15;67(1):31-40. PubMed PMID: 3047011. 2: Cordingley MG, Callahan PL, Sardana VV, Garsky VM, Colonno RJ. Substrate requirements of human rhinovirus 3C protease for peptide cleavage in vitro. J Biol Chem. 1990 Jun 5;265(16):9062-5. PubMed PMID: 2160953.

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Schistosoma GST Recombinant Protein”

Your email address will not be published. Required fields are marked *

Contact us

Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.







    X