RsbS protein(rsbS)

Reference:
Size

10ug, 100ug

Brand

Product type

Host Species

Product nameRsbS protein(rsbS)
Uniprot IDQ92DC5
Uniprot linkhttp://www.uniprot.org/uniprot/Q92DC5
Expression systemProcaryotic expression
SequenceMGIPILKLGECLLISIQSELDDHTAVEFQEDLLAKIHETSARGVVIDITSIDFIDSFIAKILGDVVSMSKLMGAKVVVTG IQPAVAITLIELGITFSGVLSAMDLESGLEKLKQELGEGSHHHHHH
Molecular weight13.53kDa
Purity estimated90% by SDS-PAGE
BufferPBS, pH 7.5
Delivery conditionDry Ice
Delivery lead time in business daysEurope: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
BrandProteoGenix
Host speciesEscherichia coli (E.coli)
Fragment Typefull length
ReferencePX-P4544
NoteFor research use only

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “RsbS protein(rsbS)”

Your email address will not be published. Required fields are marked *

Contact us

Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.