Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

RRV Spike glycoprotein E2, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Ross river virus (RRV)
Uniprot ID:
QFR08198.1

Original price was: €264.00.Current price is: €228.00.

50ug 14% OFF + 228 loyalty points
His Ser335–Gly694
Size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
RRV Spike glycoprotein E2, N-His

RRV Spike glycoprotein E2, N-His

Product name ARO-P18771-100
Uniprot ID QFR08198.1
Origin species Ross river virus (RRV)
Expression system Prokaryotic expression
Raw Antigen Sequence SVTEHFNVYKATRPYLAHCADCGDGYFCYSPVAIEKIRDEASDGMLKIQVSAQIGLDKAGTHAHTKMRYMAGHDVQESKRDSLRVYTSAACSIRGTMGHFIVAHCPPGDYLKVSFEDADSHVKACKVQYKHDPLPVGREKFVVRPHFGVELPCTSYQLTTAPTDEEIDMHTPPDIPDRTLLSQTAGNVKITAGGRTIRYNCTCGRDNVGTTSTDKTINTCKIDQCHAAVTSHDKWQFTSPFVPRADQTARKGKVHVPFPLTNVTCRVPLARAPDVTYGKKEVTLRLHPDHPTLFSYRSLGAVPHPYEEWVDKFSERIIPVTEEGIEYQWGNNPPVRLWAQLTTEGKPHGWPHEIIQYYYG
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser335-Gly694
Aliases /Synonyms Structural polyprotein, p130, Capsid protein, 3.4.21.90, Coat protein, C, Precursor of protein E3/E2, p62, pE2, Assembly protein E3, Spike glycoprotein E2, E2 envelope glycoprotein, 6K protein, Spike glycoprotein E1, E1 envelope glycoprotein
Reference ARO-P18771
Note For research use only.
Molecular Constructor
His Ser335–Gly694
Product name ARO-P18771-1MG
Uniprot ID QFR08198.1
Origin species Ross river virus (RRV)
Expression system Prokaryotic expression
Raw Antigen Sequence SVTEHFNVYKATRPYLAHCADCGDGYFCYSPVAIEKIRDEASDGMLKIQVSAQIGLDKAGTHAHTKMRYMAGHDVQESKRDSLRVYTSAACSIRGTMGHFIVAHCPPGDYLKVSFEDADSHVKACKVQYKHDPLPVGREKFVVRPHFGVELPCTSYQLTTAPTDEEIDMHTPPDIPDRTLLSQTAGNVKITAGGRTIRYNCTCGRDNVGTTSTDKTINTCKIDQCHAAVTSHDKWQFTSPFVPRADQTARKGKVHVPFPLTNVTCRVPLARAPDVTYGKKEVTLRLHPDHPTLFSYRSLGAVPHPYEEWVDKFSERIIPVTEEGIEYQWGNNPPVRLWAQLTTEGKPHGWPHEIIQYYYG
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser335-Gly694
Aliases /Synonyms Structural polyprotein, p130, Capsid protein, 3.4.21.90, Coat protein, C, Precursor of protein E3/E2, p62, pE2, Assembly protein E3, Spike glycoprotein E2, E2 envelope glycoprotein, 6K protein, Spike glycoprotein E1, E1 envelope glycoprotein
Reference ARO-P18771
Note For research use only.
Molecular Constructor
His Ser335–Gly694
Product name ARO-P18771-50
Uniprot ID QFR08198.1
Origin species Ross river virus (RRV)
Expression system Prokaryotic expression
Raw Antigen Sequence SVTEHFNVYKATRPYLAHCADCGDGYFCYSPVAIEKIRDEASDGMLKIQVSAQIGLDKAGTHAHTKMRYMAGHDVQESKRDSLRVYTSAACSIRGTMGHFIVAHCPPGDYLKVSFEDADSHVKACKVQYKHDPLPVGREKFVVRPHFGVELPCTSYQLTTAPTDEEIDMHTPPDIPDRTLLSQTAGNVKITAGGRTIRYNCTCGRDNVGTTSTDKTINTCKIDQCHAAVTSHDKWQFTSPFVPRADQTARKGKVHVPFPLTNVTCRVPLARAPDVTYGKKEVTLRLHPDHPTLFSYRSLGAVPHPYEEWVDKFSERIIPVTEEGIEYQWGNNPPVRLWAQLTTEGKPHGWPHEIIQYYYG
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser335-Gly694
Aliases /Synonyms Structural polyprotein, p130, Capsid protein, 3.4.21.90, Coat protein, C, Precursor of protein E3/E2, p62, pE2, Assembly protein E3, Spike glycoprotein E2, E2 envelope glycoprotein, 6K protein, Spike glycoprotein E1, E1 envelope glycoprotein
Reference ARO-P18771
Note For research use only.
Molecular Constructor
His Ser335–Gly694

There are no reviews yet.

Be the first to review “RRV Spike glycoprotein E2, N-His”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products