Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Rozipafusp alfa Biosimilar – Anti-B7RP1 mAb – Research Grade

  • PX-TA1920-50
  • Validated FC
Clonality:
Monoclonal Antibody
Isotype:
IgG2, Kappa

Original price was: €183.00.Current price is: €140.00.

50ug 23% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Rozipafusp alfa Biosimilar - Anti-B7RP1 mAb - Research Grade

Product name Rozipafusp alfa Biosimilar - Anti-B7RP1 mAb - Research Grade
Uniprot ID O75144 & Q9Y275
Source CAS: 2143449-47-0
Species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MRLGSPGLLFLLFSSLRADTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWSILAVLCLLVVVAVAIGWVCRDRCLQHSYAGAWAVSPETELTGHV
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms anti-B7RP1,B7-related protein 1,CD275,ICOSL,ICOSLG,KIAA0653,B7 homolog 2,ICOS ligand,B7RP-1,B7H2,B7-H2,B7-like protein Gl50,
Reference PX-TA1920
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2-kappa
Clonality Monoclonal Antibody
Product name Rozipafusp alfa Biosimilar - Anti-B7RP1 mAb - Research Grade
Uniprot ID O75144 & Q9Y275
Source CAS: 2143449-47-0
Species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MRLGSPGLLFLLFSSLRADTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWSILAVLCLLVVVAVAIGWVCRDRCLQHSYAGAWAVSPETELTGHV
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms anti-B7RP1,B7-related protein 1,CD275,ICOSL,ICOSLG,KIAA0653,B7 homolog 2,ICOS ligand,B7RP-1,B7H2,B7-H2,B7-like protein Gl50,
Reference PX-TA1920
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2-kappa
Clonality Monoclonal Antibody
Product name PX-TA1920-50
Uniprot ID O75144 & Q9Y275
Source CAS: 2143449-47-0
Species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MRLGSPGLLFLLFSSLRADTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWSILAVLCLLVVVAVAIGWVCRDRCLQHSYAGAWAVSPETELTGHV
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms anti-B7RP1,B7-related protein 1,CD275,ICOSL,ICOSLG,KIAA0653,B7 homolog 2,ICOS ligand,B7RP-1,B7H2,B7-H2,B7-like protein Gl50,
Reference PX-TA1920
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2, Kappa
Clonality Monoclonal Antibody

Introduction

Rozipafusp alfa Biosimilar is a novel biosimilar of Anti-B7RP1 monoclonal antibody (mAb) that has been developed for the treatment of various diseases. This biosimilar is a highly specific and potent therapeutic agent that targets B7RP1, a protein that is involved in regulating immune responses. In this article, we will provide a comprehensive scientific description of Rozipafusp alfa Biosimilar, including its structure, activity, and potential applications.

Structure of Rozipafusp alfa Biosimilar

Rozipafusp alfa Biosimilar is a fully humanized monoclonal antibody that has been engineered to have a high binding affinity for B7RP1. It is composed of two identical heavy chains and two identical light chains, each with a molecular weight of approximately 150 kDa. The antibody has a Y-shaped structure, with two Fab regions that bind to B7RP1 and a Fc region that mediates effector functions.

The amino acid sequence of Rozipafusp alfa Biosimilar is highly similar to that of the reference product, making it a true biosimilar. It has been produced using recombinant DNA technology in mammalian cell lines, ensuring a high level of purity and consistency in its structure and function.

Activity of Rozipafusp alfa Biosimilar

The main activity of Rozipafusp alfa Biosimilar is its ability to bind to B7RP1 with high specificity and affinity. B7RP1 is a co-stimulatory molecule that is expressed on the surface of various immune cells, including T cells, B cells, and dendritic cells. By binding to B7RP1, Rozipafusp alfa Biosimilar inhibits its interaction with its receptor, leading to the suppression of immune responses.

Studies have shown that Rozipafusp alfa Biosimilar can effectively block the activation and proliferation of T cells, which play a crucial role in the pathogenesis of various autoimmune diseases. It also inhibits the production of pro-inflammatory cytokines, such as interleukin-2 and interferon-gamma, further suppressing immune responses.

Applications of Rozipafusp alfa Biosimilar

Rozipafusp alfa Biosimilar has shown promising results in preclinical and clinical studies for the treatment of various diseases. Its main application is in the treatment of autoimmune diseases, such as rheumatoid arthritis, multiple sclerosis, and psoriasis. By targeting B7RP1, Rozipafusp alfa Biosimilar can effectively suppress the overactive immune responses that contribute to the development and progression of these diseases.

In addition to autoimmune diseases, Rozipafusp alfa Biosimilar has also shown potential in the treatment of certain types of cancer. B7RP1 is known to be overexpressed in some cancer cells, and its interaction with its receptor can promote tumor growth and survival. By blocking this interaction, Rozipafusp alfa Biosimilar can inhibit tumor growth and enhance the anti-tumor immune response.

Furthermore, Rozipafusp alfa Biosimilar has also been investigated for its potential use in organ transplantation. By suppressing immune responses, it can prevent organ rejection and improve the success rate of transplantation procedures.

Conclusion

Rozipafusp alfa Biosimilar is a highly specific and potent therapeutic agent that targets B7RP1, a protein involved in regulating immune responses. Its unique structure and activity make it a promising treatment option for various diseases, including autoimmune diseases, cancer, and organ transplantation. With its potential to improve patient outcomes and reduce healthcare costs, Rozipafusp alfa Biosimilar is a valuable addition to the arsenal of therapeutic antibodies.

Flow Cytometry results for Rozibafusp alfa Biosimilar - Anti-CD275;ICOSLG and CD257;BAFF mAb - Research Grade

Flow Cytometry results for Rozibafusp alfa Biosimilar - Anti-CD275;ICOSLG and CD257;BAFF mAb - Research Grade

Flow-cytometry using anti-human CD275 antibody. U937 cells were stained with an irrelevant antibody (Blue Histogram) or an anti-human CD275 monoclonal antibody (Catalog: PX-TA1920, Yellow Histogram) at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using a Goat Anti-Human IgG H&L Polyclonal Antibody, FITC (abinScience: PTX18862) and cells analysed on a NovoCyte Flow Cytometer.

Rozipafusp alfa Biosimilar - Anti-B7RP1 mAb - Research Grade

There are no reviews yet.

Be the first to review “Rozipafusp alfa Biosimilar – Anti-B7RP1 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products