Cart (0 Items)
Your cart is currently empty.
View Products-
-
-
Ribonucleoside-diphosphate reductase subunit M2 B(RRM2B)
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Escherichia coli (E. coli) |
| Applications | Elisa, WB |
| Product name | Ribonucleoside-diphosphate reductase subunit M2 B(RRM2B) |
|---|---|
| Uniprot ID | Q7LG56 |
| Uniprot link | https://www.uniprot.org/uniprot/Q7LG56 |
| Origin species | Homo sapiens (Human) |
| Expression system | Prokaryotic expression |
| Sequence | MGDPERPEAAGLDQDERSSSDTNESEIKSNEEPLLRKSSRRFVIFPIQYPDIWKMYKQAQASFWTAEEVDLS KDLPHWNKLKADEKYFISHILAFFAASDGIVNENLVERFSQEVQVPEARCFYGFQILIENVHSEMYSLLIDT YIRDPKKREFLFNAIETMPYVKKKADWALRWIADRKSTFGERVVAFAAVEGVFFSGSFAAIFWLKKRGLMPG LTFSNELISRDEGLHCDFACLMFQYLVNKPSEERVREIIVDAVKIEQEFLTEALPVGLIGMNCILMKQYIEF VADRLLVELGFSKVFQAENPFDFMENISLEGKTNFFEKRVSEYQRFAVMAETTDNVFTLDADF |
| Molecular weight | 40.74 kDa |
| Protein delivered with Tag? | N terminus His tag |
| Purity estimated | >90% by SDS-PAGE |
| Buffer | PBS pH 7.5 |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Met1-Phe351 |
| Protein Accession | Q7LG56 |
| Spec:Entrez GeneID | 50484 |
| Spec:NCBI Gene Aliases | P53R2; MTDPS8A; MTDPS8B |
| Spec:SwissProtID | Q17RZ6 |
| NCBI Reference | Q7LG56 |
| Aliases /Synonyms | TP53-inducible ribonucleotide reductase M2 B,p53-inducible ribonucleotide reductase small subunit 2-like protein,p53R2,P53R2 |
| Reference | PX-P4793 |
| Note | For research use only |
Related products
Tag Antibody
Anti His tag mouse monoclonal antibody
PTX17851 180€Contact us
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.