Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Yersinia enterocolitica ail/Attachment invasion locus Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Yersinia enterocolitica
Uniprot ID:
P16454
Molecular weight:
29.64 kDa

Original price was: €271.00.Current price is: €230.00.

50ug 15% OFF + 230 loyalty points
Ala24–Phe178
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Yersinia enterocolitica ail/Attachment invasion locus Protein, N-His-SUMO

Product name ARO-P10914-100
Uniprot ID P16454
Origin species Yersinia enterocolitica
Expression system Prokaryotic expression
Raw Antigen Sequence ASESSISIGYAQSHVKENGYTLDNDPKGFNLKYRYELDDNWGVIGSFAYTHQGYDFFYGSNKFGHGDVDYYSVTMGPSFRINEYVSLYGLLGAAHGKVKASVFDESISASKTSMAYGAGVQFNPLPNFVIDASYEYSKLDSIKVGTWMLGAGYRF
Molecular weight 29.64 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala24-Phe178
Aliases /Synonyms Attachment invasion locus protein, ail
Reference ARO-P10914
Note For research use only.
Molecular Constructor
Ala24–Phe178
Product name ARO-P10914-1MG
Uniprot ID P16454
Origin species Yersinia enterocolitica
Expression system Prokaryotic expression
Raw Antigen Sequence ASESSISIGYAQSHVKENGYTLDNDPKGFNLKYRYELDDNWGVIGSFAYTHQGYDFFYGSNKFGHGDVDYYSVTMGPSFRINEYVSLYGLLGAAHGKVKASVFDESISASKTSMAYGAGVQFNPLPNFVIDASYEYSKLDSIKVGTWMLGAGYRF
Molecular weight 29.64 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala24-Phe178
Aliases /Synonyms Attachment invasion locus protein, ail
Reference ARO-P10914
Note For research use only.
Molecular Constructor
Ala24–Phe178
Product name ARO-P10914-50
Uniprot ID P16454
Origin species Yersinia enterocolitica
Expression system Prokaryotic expression
Raw Antigen Sequence ASESSISIGYAQSHVKENGYTLDNDPKGFNLKYRYELDDNWGVIGSFAYTHQGYDFFYGSNKFGHGDVDYYSVTMGPSFRINEYVSLYGLLGAAHGKVKASVFDESISASKTSMAYGAGVQFNPLPNFVIDASYEYSKLDSIKVGTWMLGAGYRF
Molecular weight 29.64 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala24-Phe178
Aliases /Synonyms Attachment invasion locus protein, ail
Reference ARO-P10914
Note For research use only.
Molecular Constructor
Ala24–Phe178

Introduction

The Recombinant Yersinia enterocolitica ail/Attachment invasion locus Protein, also known as Ail protein, is a key virulence factor in the pathogenesis of Yersinia enterocolitica, a gram-negative bacterium that causes foodborne illness in humans. The Ail protein is a surface-exposed outer membrane protein that plays a crucial role in the attachment and invasion of host cells by Y. enterocolitica. In recent years, the recombinant form of this protein has gained significant attention in the field of biotechnology and medicine due to its potential applications in vaccine development and diagnostic assays.

Structure of Recombinant Ail Protein

The Ail protein is a 17 kDa outer membrane protein that is highly conserved among different Yersinia species. It is composed of 159 amino acids and has a predicted β-barrel structure with eight transmembrane β-strands and four extracellular loops. The recombinant form of Ail protein is produced by cloning the full-length gene into an expression vector and expressing it in a suitable host organism, such as Escherichia coli. The recombinant protein retains its native structure and function and can be purified using standard protein purification techniques.

Activity of Recombinant Ail Protein

The Ail protein is a multifunctional protein that plays a crucial role in the pathogenesis of Y. enterocolitica. It acts as an adhesin, allowing the bacterium to attach to host cells, particularly intestinal epithelial cells. It also functions as an invasin, facilitating the entry of Y. enterocolitica into host cells by interacting with host cell receptors. In addition, the Ail protein has been shown to have immunomodulatory effects, suppressing the host’s immune response and aiding the survival of the bacterium in the host.

Application of Recombinant Ail Protein

Recombinant Ail protein has several potential applications in the fields of biotechnology and medicine.

Vaccine Development

The Ail protein has been identified as a potential vaccine candidate for Y. enterocolitica. Recombinant Ail protein can be used to develop subunit vaccines, which are safer and more specific than traditional live attenuated vaccines. Studies have shown that vaccination with recombinant Ail protein can protect mice from lethal Y. enterocolitica infection, making it a promising candidate for the development of a human vaccine.

Diagnostic Assays

The Ail protein has been shown to be highly immunogenic, making it a potential antigen for the development of diagnostic assays for Y. enterocolitica. Recombinant Ail protein can be used in serological assays, such as ELISA, to detect the presence of antibodies against Y. enterocolitica in patient samples. It can also be used in lateral flow assays for rapid and point-of-care diagnosis of Y. enterocolitica infection.

Therapeutic Applications

The Ail protein has been shown to have immunomodulatory effects, making it a potential therapeutic target for the treatment of inflammatory and autoimmune diseases. Recombinant Ail protein can be used to develop immunomodulatory therapies that target specific immune cells or pathways, offering a more targeted and effective treatment option.

Future Directions

Further research is needed to fully understand the structure and function of the Ail protein and its potential applications. Studies are ongoing to determine the effectiveness of recombinant Ail protein as a vaccine candidate and its potential as a diagnostic and therapeutic tool. Additionally, efforts are being made to develop more efficient and cost-effective methods for the production of recombinant Ail protein.

Conclusion

The Recombinant Yersinia enterocolitica ail/Attachment invasion locus Protein is a key virulence factor in Y.

Recombinant Yersinia enterocolitica ail/Attachment invasion locus Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Yersinia enterocolitica ail/Attachment invasion locus Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products