Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant SARS-CoV-2 S Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Uniprot ID:
P0DTC2
Molecular weight:
19.21 kDa

325.00

100ug + 325 loyalty points
His Asn679–Phe833
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Recombinant SARS-CoV-2 S Protein, N-His

Recombinant SARS-CoV-2 S Protein, N-His

Product name Recombinant SARS-CoV-2 S Protein, N-His
Uniprot ID P0DTC2
Origin species Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Expression system Prokaryotic expression
Raw Antigen Sequence NSPRRARSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKNTQEVFAQVKQIYKTPPIKDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGF
Molecular weight 19.21 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn679-Phe833
Aliases /Synonyms Spike glycoprotein, S glycoprotein, E2, Peplomer protein, Spike protein S1, Spike protein S2, Spike protein S2', S
Reference PX-COV-P011
Note For research use only.
Molecular Constructor
His Asn679–Phe833

There are no reviews yet.

Be the first to review “Recombinant SARS-CoV-2 S Protein, N-His”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products