Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Pseudomonas aeruginosa PcrV Protein, N-His & N-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Pseudomonas aeruginosa
Uniprot ID:
G3XD49
Molecular weight:
30.43 kDa

Original price was: €253.00.Current price is: €230.00.

50ug 9% OFF + 230 loyalty points
Leu132–Ile294
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Pseudomonas aeruginosa PcrV Protein, N-His & N-SUMO

Product name ARO-P12724-100
Uniprot ID G3XD49
Origin species Pseudomonas aeruginosa
Expression system Prokaryotic expression
Raw Antigen Sequence LDELKALTAELKVYSVIQSQINAALSAKQGIRIDAGGIDLVDPTLYGYAVGDPRWKDSPEYALLSNLDTFSGKLSIKDFLSGSPKQSGELKGLSDEYPFEKDNNPVGNFATTVSDRSRPLNDKVNEKTTLLNDTSSRYNSAVEALNRFIQKYDSVLRDILSAI
Molecular weight 30.43 kDa
Buffer 0.01M PBS, pH 7.4.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu132-Ile294
Aliases /Synonyms Type III secretion protein PcrV, pcrV, PA1706
Reference ARO-P12724
Note For research use only.
Molecular Constructor
Leu132–Ile294
Product name ARO-P12724-1MG
Uniprot ID G3XD49
Origin species Pseudomonas aeruginosa
Expression system Prokaryotic expression
Raw Antigen Sequence LDELKALTAELKVYSVIQSQINAALSAKQGIRIDAGGIDLVDPTLYGYAVGDPRWKDSPEYALLSNLDTFSGKLSIKDFLSGSPKQSGELKGLSDEYPFEKDNNPVGNFATTVSDRSRPLNDKVNEKTTLLNDTSSRYNSAVEALNRFIQKYDSVLRDILSAI
Molecular weight 30.43 kDa
Buffer 0.01M PBS, pH 7.4.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu132-Ile294
Aliases /Synonyms Type III secretion protein PcrV, pcrV, PA1706
Reference ARO-P12724
Note For research use only.
Molecular Constructor
Leu132–Ile294
Product name ARO-P12724-50
Uniprot ID G3XD49
Origin species Pseudomonas aeruginosa
Expression system Prokaryotic expression
Raw Antigen Sequence LDELKALTAELKVYSVIQSQINAALSAKQGIRIDAGGIDLVDPTLYGYAVGDPRWKDSPEYALLSNLDTFSGKLSIKDFLSGSPKQSGELKGLSDEYPFEKDNNPVGNFATTVSDRSRPLNDKVNEKTTLLNDTSSRYNSAVEALNRFIQKYDSVLRDILSAI
Molecular weight 30.43 kDa
Buffer 0.01M PBS, pH 7.4.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu132-Ile294
Aliases /Synonyms Type III secretion protein PcrV, pcrV, PA1706
Reference ARO-P12724
Note For research use only.
Molecular Constructor
Leu132–Ile294

Recombinant Pseudomonas aeruginosa PcrV Protein: Structure, Activity and Application

Introduction

Pseudomonas aeruginosa is a Gram-negative bacterium commonly found in soil, water and plants. It is also an opportunistic human pathogen that can cause severe infections in immunocompromised individuals. One of the major virulence factors of P. aeruginosa is the PcrV protein, which plays a crucial role in the pathogenesis of the bacterium. With the advancements in recombinant DNA technology, the production of recombinant PcrV protein has become possible, leading to its potential use as an antigen in vaccine development and as a therapeutic target for P. aeruginosa infections.

Structure of Recombinant PcrV Protein

The PcrV protein is a type III secretion system (T3SS) effector protein, which is composed of 294 amino acids. It is a highly conserved protein among various P. aeruginosa strains and is essential for the translocation of other T3SS effector proteins into host cells. The recombinant PcrV protein is produced by cloning the gene encoding for PcrV into an expression vector and expressing it in a suitable host system. The resulting protein is similar in structure to the native PcrV protein and is capable of eliciting an immune response against P. aeruginosa.

Activity of Recombinant PcrV Protein

The PcrV protein is known to play a crucial role in the pathogenesis of P. aeruginosa by facilitating the injection of other T3SS effector proteins into host cells. These effector proteins manipulate the host cell signaling pathways, leading to the disruption of the host immune response and promoting bacterial survival. The recombinant PcrV protein is capable of binding to host cells and eliciting an immune response, making it a potential antigen for vaccine development. It has also been shown to inhibit the translocation of other T3SS effector proteins, making it a potential therapeutic target for P. aeruginosa infections.

Application of Recombinant PcrV Protein

The recombinant PcrV protein has shown promising results in vaccine development against P. aeruginosa infections. Studies have shown that immunization with recombinant PcrV protein can induce a protective immune response against P. aeruginosa in animal models. It has also been found to be effective in combination with other antigens in developing a multivalent vaccine against P. aeruginosa. Furthermore, the recombinant PcrV protein has also shown potential as a therapeutic target for P. aeruginosa infections. Inhibition of PcrV activity has been shown to reduce the virulence of P. aeruginosa and increase the susceptibility of the bacterium to antibiotics.

Conclusion

The recombinant PcrV protein is a promising antigen for vaccine development and a potential therapeutic target for P. aeruginosa infections. Its structural similarity to the native protein and its ability to elicit an immune response make it a valuable tool in the fight against P. aeruginosa. Further research and development in this field can lead to the development of effective vaccines and treatments for P. aeruginosa infections.

Recombinant Pseudomonas aeruginosa PcrV Protein, N-His & N-SUMO

There are no reviews yet.

Be the first to review “Recombinant Pseudomonas aeruginosa PcrV Protein, N-His & N-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products